IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ VDAC2 inhibits BAK activation and mitochondrial apoptosis. VDAC2 inhibits BAK activation and mitochondrial apoptosis. Science (0036-8075) 2003 imex curation Cheng E.H., Sheiko T.V., Fisher J.K., Craigen W.J., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The coinmunoprecipitation was performed using purified mitochondria from FL5.12 cells. stanley_korsmeyer@dfci.harvard.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-fl5.12 murine FL5.12 pro-B-cell lymphoid cell line fl5.12 FL5.12 murine pro-B-cell lymphoid cell line, dependent on IL3 anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Cheng E.H., Sheiko T.V., Fisher J.K., Craigen W.J., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The coinmunoprecipitation was performed using purified mitochondria from FL5.12 cells. stanley_korsmeyer@dfci.harvard.edu Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Science (0036-8075) 2003 Only protein-protein interactions imex curation VDAC2 inhibits BAK activation and mitochondrial apoptosis. VDAC2 inhibits BAK activation and mitochondrial apoptosis. Science (0036-8075) 2003 imex curation Cheng E.H., Sheiko T.V., Fisher J.K., Craigen W.J., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The coinmunoprecipitation was performed using purified mitochondria from FL5.12 cells. stanley_korsmeyer@dfci.harvard.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheng E.H., Sheiko T.V., Fisher J.K., Craigen W.J., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The coinmunoprecipitation was performed using purified mitochondria from FL5.12 cells. stanley_korsmeyer@dfci.harvard.edu Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Science (0036-8075) 2003 Only protein-protein interactions imex curation VDAC2 inhibits BAK activation and mitochondrial apoptosis. VDAC2 inhibits BAK activation and mitochondrial apoptosis. Science (0036-8075) 2003 imex curation Cheng E.H., Sheiko T.V., Fisher J.K., Craigen W.J., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The coinmunoprecipitation was performed using purified mitochondria from FL5.12 cells. stanley_korsmeyer@dfci.harvard.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-fl5.12 murine FL5.12 pro-B-cell lymphoid cell line fl5.12 FL5.12 murine pro-B-cell lymphoid cell line, dependent on IL3 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheng E.H., Sheiko T.V., Fisher J.K., Craigen W.J., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The coinmunoprecipitation was performed using purified mitochondria from FL5.12 cells. stanley_korsmeyer@dfci.harvard.edu Accepted 2012-FEB-10 by JYOTI Science (0036-8075) 2003 Only protein-protein interactions imex curation bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10417 original sequence version: 71 DIP protein P10417 original sequence version: 126 80FDCFE78C735092 bak_mouse Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bak1 Bak protein protein mouse Mus musculus Mouse MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS DIP protein O08734 original sequence version: 116 DIP protein O08734 original sequence version: 66 DIP protein O08734 original sequence version: 114 DIP protein O08734 original sequence version: 129 49972D3CA21F4218 vdac2_mouse Voltage-dependent anion-selective channel protein 2 Voltage-dependent anion-selective channel protein 6 Outer mitochondrial membrane protein porin 2 Vdac2 Vdac6 protein protein mouse Mus musculus Mouse MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELEA 7BBCDC625AD013C7 bcl2-bak1 3 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association S1 Treatment of the cells with recombinant tBid is required for the interaction to happen. bak1-vdac2-1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5b vdac2-bak1 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2e bak1-vdac2-2 2 5 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey physical association physical association 2e