UniProt UniProt http://www.uniprot.org HSpin1, a transmembrane protein interacting with Bcl-2/Bcl-xL, induces a caspase-independent autophagic cell death. HSpin1, a transmembrane protein interacting with Bcl-2/Bcl-xL, induces a caspase-independent autophagic cell death. Cell Death Differ. (1350-9047) 2003 imex curation Yanagisawa H., Miyashita T., Nakano Y., Yamamoto D. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 cells have been transfected with Flag-BCL2L1 and mutant or wildtype GFP-SPNS1. daichan@aseda.jp 12-Oct-2007: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Yanagisawa H., Miyashita T., Nakano Y., Yamamoto D. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 cells have been transfected with Flag-BCL2L1 and mutant or wildtype GFP-SPNS1. daichan@aseda.jp Accepted 2007-OCT-24 by JYOTI. 12-Oct-2007: Contacted by JYOTI. Cell Death Differ. (1350-9047) 2003 Only protein-protein interactions imex curation HSpin1, a transmembrane protein interacting with Bcl-2/Bcl-xL, induces a caspase-independent autophagic cell death. HSpin1, a transmembrane protein interacting with Bcl-2/Bcl-xL, induces a caspase-independent autophagic cell death. Cell Death Differ. (1350-9047) 2003 imex curation Yanagisawa H., Miyashita T., Nakano Y., Yamamoto D. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 cells have been transfected with Flag-BCL2L1 and mutant or wildtype GFP-SPNS1. daichan@aseda.jp 12-Oct-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yanagisawa H., Miyashita T., Nakano Y., Yamamoto D. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 cells have been transfected with Flag-BCL2L1 and mutant or wildtype GFP-SPNS1. daichan@aseda.jp Accepted 2007-OCT-24 by JYOTI. 12-Oct-2007: Contacted by JYOTI. Cell Death Differ. (1350-9047) 2003 Only protein-protein interactions imex curation HSpin1, a transmembrane protein interacting with Bcl-2/Bcl-xL, induces a caspase-independent autophagic cell death. HSpin1, a transmembrane protein interacting with Bcl-2/Bcl-xL, induces a caspase-independent autophagic cell death. Cell Death Differ. (1350-9047) 2003 imex curation Yanagisawa H., Miyashita T., Nakano Y., Yamamoto D. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 cells have been transfected with Flag-BCL2L1 and mutant or wildtype GFP-SPNS1. daichan@aseda.jp 12-Oct-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Yanagisawa H., Miyashita T., Nakano Y., Yamamoto D. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 cells have been transfected with Flag-BCL2L1 and mutant or wildtype GFP-SPNS1. daichan@aseda.jp Accepted 2007-OCT-24 by JYOTI. Cell Death Differ. (1350-9047) 2003 Only protein-protein interactions imex curation spns1_human Protein spinster homolog 1 Spinster-like protein 1 HSpin1 PP20300 SPNS1 SPIN1 protein protein human Homo sapiens Human MAGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRITGLSPGRSALIVAVLCYINLLNYMDRFTVAGVLPDIEQFFNIGDSSSGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPGEHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDMAGDWHWALRVTPGLGVVAVLLLFLVVREPPRGAVERHSDLPPLNPTSWWADLRALARNPSFVLSSLGFTAVAFVTGSLALWAPAFLLRSRVVLGETPPCLPGDSCSSSDSLIFGLITCLTGVLGVGLGVEISRRLRHSNPRADPLVCATGLLGSAPFLFLSLACARGSIVATYIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRSTRVPVASVLI F1B9D2EB3F9F1B48 sdhb_human Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial SDHB SDH SDH1 Iron-sulfur subunit of complex II protein protein human Homo sapiens Human MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV DIP protein P21912 original sequence version: 198 ED12E7C3BA7B6D13 bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB cyc_human Cytochrome c CYCS CYC protein protein human Homo sapiens Human MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE DIP protein P99999 original sequence version: 59 8EE9689E0102506B b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK E09D3CDD851AE9BE bcl2-spns1-1 3 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3a bcl2l1-spns1-1 3 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3a spns1-sdhb-1 1 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2a spns1-bcl2-2 1 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2a spns1-bcl2l1-2 1 4 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2a spns1-cycs-1 1 4 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 5b spns1-bcl2l1-1 2 4 unspecified role unspecified role bait bait n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range val82-ile86 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4b