IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. (0261-4189) 2003 Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro immunodepletion immunodepleted coimmunoprecipitation immunodepleted coip immunodepletion western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis co-depletion. Lysate selectively depleted in bait is also depleted in protein preys. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. (0261-4189) 2003 Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. (0261-4189) 2003 Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. (0261-4189) 2003 Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. (0261-4189) 2003 Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis the peptide bait is immobilized on streptavidin-agarose and tests for ability to bind proteins Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. (0261-4189) 2003 Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. (0261-4189) 2003 Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2003 gga3_human ADP-ribosylation factor-binding protein GGA3 Golgi-localized, gamma ear-containing, ARF-binding protein 3 GGA3 KIAA0154 protein protein human Homo sapiens Human MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQVINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPPQASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL DIP protein Q9NZ52 original sequence version: 134 4F80D6032239168C ap1g1_human AP-1 complex subunit gamma-1 Adaptor protein complex AP-1 subunit gamma-1 Golgi adaptor HA1/AP1 adaptin subunit gamma-1 Gamma1-adaptin Clathrin assembly protein complex 1 gamma-1 large chain AP1G1 ADTG CLAPG1 Adaptor-related protein complex 1 subunit gamma-1 protein protein human Homo sapiens Human MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHIDTIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTVNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPSSAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ 42EF40223DFBA5E9 gga1_human ADP-ribosylation factor-binding protein GGA1 Golgi-localized, gamma ear-containing, ARF-binding protein 1 Gamma-adaptin-related protein 1 GGA1 protein protein human Homo sapiens Human MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQPSASVSLLDDELMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQPVPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL B0B6F089FA0F7DD5 ap1g2_human AP-1 complex subunit gamma-like 2 AP1G2 Gamma2-adaptin protein protein human Homo sapiens Human MVVPSLKLQDLIEEIRGAKTQAQEREVIQKECAHIRASFRDGDPVHRHRQLAKLLYVHMLGYPAHFGQMECLKLIASSRFTDKRVGYLGAMLLLDERHDAHLLITNSIKNDLSQGIQPVQGLALCTLSTMGSAEMCRDLAPEVEKLLLQPSPYVRKKAILTAVHMIRKVPELSSVFLPPCAQLLHERHHGILLGTITLITELCERSPAALRHFRKVVPQLVHILRTLVTMGYSTEHSISGVSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLFETVLTIMDIRSAAGLRVLAVNILGRFLLNSDRNIRYVALTSLLRLVQSDHSAVQRHRPTVVECLRETDASLSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPTKRWHIDTILHVLTTAGTHVRDDAVANLTQLIGGAQELHAYSVRRLYNALAEDISQQPLVQVAAWCIGEYGDLLLAGNCEEIEPLQVDEEEVLALLEKVLQSHMSLPATRGYALTALMKLSTRLCGDNNRIRQVVSIYGSCLDVELQQRAVEYDTLFRKYDHMRAAILEKMPLVERDGPQADEEAKESKEAAQLSEAAPVPTEPQASQLLDLLDLLDGASGDVQHPPHLDPSPGGALVHLLDLPCVPPPPAPIPDLKVFEREGVQLNLSFIRPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLPVESWQ DIP protein O75843 original sequence version: 137 C189192C9811111C gga2_human ADP-ribosylation factor-binding protein GGA2 Golgi-localized, gamma ear-containing, ARF-binding protein 2 Gamma-adaptin-related protein 2 VHS domain and ear domain of gamma-adaptin GGA2 KIAA1080 protein protein human Homo sapiens Human MAATAVAAAVAGTESAQGPPGPAASLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHKIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNHPEDLQAANRLIKNLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSMYRRPGQAPPDQEALQVVYERCEKLRPTLFRLASDTTDDDDALAEILQANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPVTGMVSGQNCCEEKRNPSSSTLPGGGVQNPSADRNLLDLLSAQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTPLAQVFVPLESVKPSSLPPLIVYDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPKSMRVKLQPASSSKLPAFSPLMPPAVISQMLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAVLGAA 4B627ABA474A069C clh1_bovin Clathrin heavy chain 1 CLTC protein protein bovin Bos taurus (Bovine) Bovine MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPAYGQPQPGFGYSM DIP protein P49951 original sequence version: 108 6C4F2D54801579E2 rabe1_human Rab GTPase-binding effector protein 1 Rabaptin-5 Rabaptin-5alpha Rabaptin-4 Renal carcinoma antigen NY-REN-17 RABEP1 RABPT5 RABPT5A RAB5EP protein protein human Homo sapiens Human MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQNAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMKETVRDYEHQFHLRLEQERTQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASKVKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVCALTQEESSAQLSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET DIP protein Q15276 original sequence version: 59 CAAF91638B8ED516 rabx5_bovin Rab5 GDP/GTP exchange factor Rabex-5 RABGEF1 RABEX5 protein protein bovin Bos taurus (Bovine) Bovine MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGAKKAEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEAMHYKRDLSIEEQSECTQDFYQNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESENWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIRPPNQSVAAIDSENVENDKLPPPLQPQVYAG DIP protein O18973 original sequence version: 39 98828A4344B15EE7 rabgef1-ap1g2-1 2 15 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association adaptin gamma 2 ear domain is used (670-785) adaptin gamma 2 ear is GST tagged revisit when feature and tag editor is in place rabgef1-gga1-1 2 15 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association GGA1 GAE domain is used (515-639) revisit when feature and tag editor is in place GGA1 is GST tagged Amount of Rabex-5 bound to GGA1-GAE is decreased when the bovin brain lysat is depleted from Rabaptin-5 suggesting a tri-complex rabgef1-gga3-1 2 15 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association the GGA3 fragment used is composed of GAE domain and part of the hinge domain (494-723) GGA3 is GST tagged revisit when feature and tag editor is in place rabgef1-gga2-1 2 15 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association the GGA2 fragment used is composed of GAE domain and the hinge domain (331-613) revisit when feature and tag editor is in place GGA2 is GST tagged rabgef1-gga1-2 1 15 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait gae domain gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association gga1-rabep1-4 6 12 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association gga1-rabep1-5 4 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association GGA1 is GFP tagged gga2-rabep1-1 4 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association GGA2 is GFP tagged revisit when protein editor is in place gga3-rabep1-1 4 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association GGA3 is GFP tagged gga1-rabep1-6 3 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association GGA1 fragment used is GAT domain (148-314) Rabaptin-5 binding fragment used is 551-661 revisit when protein editor is in place gga2-rabep1-3 3 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association GGA2 fragment used is GAT domain (164-330) Rabaptin-5 binding fragment used is 551-661 revisit when protein editor is in place gga3-rabep1-2 3 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association GGA3 fragment used is GAE domain (494-723) Rabaptin-5 binding fragment is 5-546 revisit when protein editor is in place gga2-rabep1-2 3 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association GGA2 fragment used is GAE domain (489-723) Rabaptin-5 binding fragment used is 5-546 revisit when protein editor is in place gga3-rabep1-3 3 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association revisit when protein editor is in place GGA3 fragment used is GAE domain (494-723) 428-455 rabaptin-5 fragment binds GGA3 GAE domain but with lower affinity than the full-length Rabaptin-5 binding fragment is 428-455 gga2-rabep1-4 3 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association GGA2 fragment used is GAE domain (489-723) revisit when protein editor is in place Rabaptin-5 fragment used is 428-455 Rabaptin-5 428-455 fragment binds GGA2 GAE domain but with lower affinity than the Rabaptin-5 full-length gga1-rabep1-7 3 14 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association GGA1 fragment used is GAE domain (515-639) Rabaptin-5 binding fragment used is 5-476 revisit when protein editor is in place motif FGXLV of Rabaptin-5 (439-443) is important for binding as shown by alanine scanning. gga2-rabep1-5 3 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association GGA2 fragment used is GAE domain (489-723) revisit when protein editor is in place Rabaptin-5 fragment used is 5-476 motif FGXLV of Rabaptin-5 (439-443) is important for binding as shown by alanine scanning. gga3-rabep1-4 3 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association revisit when protein editor is in place GGA3 fragment used is GAE domain (494-723) Rabaptin-5 binding fragment is 5-476 motif FGXLV of Rabaptin-5 (439-443) is important for binding as shown by alanine scanning. ap1g1-rabep1-1 3 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Rabaptin-5 binding fragment used is 5-476 revisit when protein editor is in place F439, G440 and L442 of Rabaptin-5 are important for binding as shown by alanine scanning. adaptin gamma 1 ear domain is used (707-822) ap1g2-rabep1-1 3 11 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Rabaptin-5 binding fragment used is 5-476 revisit when protein editor is in place F439, G440 and L442 of Rabaptin-5 are important for binding as shown by alanine scanning. adaptin gamma 2 ear domain is used (670-785) ap1g1-rabep1-2 5 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Rabaptin-5 binding peptide corresponds to 435-447 revisit when protein editor is in place F439, L442 of Rabaptin-5 are important for binding as shown by alanine scanning. adaptin gamma 1 ear domain is used (707-822) ap1g2-rabep1-2 5 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Rabaptin-5 peptide corresponds to 435-447 revisit when protein editor is in place F439 and L442 of Rabaptin-5 are important for binding as shown by alanine scanning. adaptin gamma 2 ear domain is used (670-785) gga1-rabep1-8 5 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association Rabaptin-5 binding peptide corresponds to 435-447 revisit when protein editor is in place F439, L442 of Rabaptin-5 are important for binding as shown by alanine scanning. GAE domain of GAA1 is used (515-639) cltc-gga2-1 7 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association the GGA2 fragment used is composed of GAE domain and the hinge domain (331-613) revisit when feature and tag editor is in place GGA2 is GST tagged Rabaptin-5 (5-546 fragment) competes with this GGA2/clathrin interaction