IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cloning of MASK, a novel member of the mammalian germinal center kinase III subfamily, with apoptosis-inducing properties. Cloning of MASK, a novel member of the mammalian germinal center kinase III subfamily, with apoptosis-inducing properties. J. Biol. Chem. (0021-9258) 2002 Dan I., Ong SE., Watanabe NM., Blagoev B., Nielsen MM., Kajikawa E., Kristiansen TZ., Mann M., Pandey A. Apoptosis - Interactions involving proteins with a function related to apoptosis Table 1 pandey@cebi.sdu.dk yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dan I., Ong SE., Watanabe NM., Blagoev B., Nielsen MM., Kajikawa E., Kristiansen TZ., Mann M., Pandey A. Apoptosis - Interactions involving proteins with a function related to apoptosis Table 1 pandey@cebi.sdu.dk J. Biol. Chem. (0021-9258) 2002 Cloning of MASK, a novel member of the mammalian germinal center kinase III subfamily, with apoptosis-inducing properties. Cloning of MASK, a novel member of the mammalian germinal center kinase III subfamily, with apoptosis-inducing properties. J. Biol. Chem. (0021-9258) 2002 Dan I., Ong SE., Watanabe NM., Blagoev B., Nielsen MM., Kajikawa E., Kristiansen TZ., Mann M., Pandey A. Apoptosis - Interactions involving proteins with a function related to apoptosis Table 1 pandey@cebi.sdu.dk human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Dan I., Ong SE., Watanabe NM., Blagoev B., Nielsen MM., Kajikawa E., Kristiansen TZ., Mann M., Pandey A. Apoptosis - Interactions involving proteins with a function related to apoptosis Proteins were 35S labelled but this does not appear to have been used as part of the identification process Table 1 pandey@cebi.sdu.dk J. Biol. Chem. (0021-9258) 2002 Cloning of MASK, a novel member of the mammalian germinal center kinase III subfamily, with apoptosis-inducing properties. Cloning of MASK, a novel member of the mammalian germinal center kinase III subfamily, with apoptosis-inducing properties. J. Biol. Chem. (0021-9258) 2002 Dan I., Ong SE., Watanabe NM., Blagoev B., Nielsen MM., Kajikawa E., Kristiansen TZ., Mann M., Pandey A. Apoptosis - Interactions involving proteins with a function related to apoptosis Table 1 pandey@cebi.sdu.dk human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. protein kinase assay protein kinase assay predetermined predetermined participant predetermined Dan I., Ong SE., Watanabe NM., Blagoev B., Nielsen MM., Kajikawa E., Kristiansen TZ., Mann M., Pandey A. Apoptosis - Interactions involving proteins with a function related to apoptosis Table 1 pandey@cebi.sdu.dk J. Biol. Chem. (0021-9258) 2002 stk26_human Serine/threonine-protein kinase 26 STK26 MASK MST3 and SOK1-related kinase MST4 Mammalian STE20-like protein kinase 4 Serine/threonine-protein kinase MASK protein protein human Homo sapiens Human MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP 3E31B7E3CBDA5768 mst4-mst4-1 1 4 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey c-terminus binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-618258]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 417-417, sequence length 416 [EBI-618258]318-417 physical association physical association mst4-mst4-2 2 4 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-618272]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 417-417, sequence length 416 [EBI-618272]318-417 region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-618274]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 417-417, sequence length 416 [EBI-618274]318-417 region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 11 physical association physical association mst4-mst4-3 2 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-618284]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 417-417, sequence length 416 [EBI-618284]318-417 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-618288]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 417-417, sequence length 416 [EBI-618288]318-417 region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mst4-mst4-4 3 4 enzyme target enzyme target substrate substrate unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 enzyme enzyme unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9P289:p.Lys53Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 19:10:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys53glu' Tue Jun 30 18:05:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys53Glu' phosphorylation phosphorylation reaction phosphorylation Probably a trans-phosphorylation within a dimer rather than a true autophosphorylation By the C-terminal 99 amino acids of the protein