MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Caspase-10 is an initiator caspase in death receptor signaling. Caspase-10 is an initiator caspase in death receptor signaling. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis no human-jurkat Homo sapiens jurkat Human T cell leukemia crosslink cross-linking study crosslink predetermined predetermined participant predetermined Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis no Subclone of Jurkat cell line used (I9.2) - caspase-8 deficient Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Caspase-10 is an initiator caspase in death receptor signaling. Caspase-10 is an initiator caspase in death receptor signaling. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis no human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret monoclonal western monoclonal antibody western blot monoclonal western Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Caspase-10 is an initiator caspase in death receptor signaling. Caspase-10 is an initiator caspase in death receptor signaling. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis no human-jurkat Homo sapiens jurkat Human T cell leukemia fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret monoclonal western monoclonal antibody western blot monoclonal western Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis no Subclone of Jurkat cell line used (I9.2) - caspase-8 deficient Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Caspase-10 is an initiator caspase in death receptor signaling. Caspase-10 is an initiator caspase in death receptor signaling. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis no human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip monoclonal western monoclonal antibody western blot monoclonal western Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 q92851-3 Caspase-10 10-C CASP10 MCH4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 ICE-like apoptotic protease 4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNEGSCVQDESEPQRPLCHCQQPQLYLPEGQTRNP May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. 1146630514EE38DC tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV 0139942535111410 caspa_human Caspase-10 ICE-like apoptotic protease 4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 CASP10 MCH4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKTMEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS 840348AE602B8243 casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F fadd-tnfrsf6-1 4 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey association association Anti-Fas caspa-caspa-1 1 6 unspecified role unspecified role neutral component neutral component physical association physical association Cleavage and auto-activation casp8-casp8-1 3 9 unspecified role unspecified role neutral component neutral component yfp-tag c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component cfp-tag c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction casp8-caspa-1 3 9 unspecified role unspecified role neutral component neutral component cfp-tag c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component yfp-tag c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction casp8-casp8-3 2 9 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 33 30 direct interaction direct interaction Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein casp8-caspa-2 2 9 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 37 40 direct interaction direct interaction Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein casp8-fadd-1 2 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 44 47 direct interaction direct interaction Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein caspa-caspa-2 2 8 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role fluorescence donor fluorescence donor region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 53 50 direct interaction direct interaction Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein casp8-caspa-3 2 9 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein casp10-fadd-1 2 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain c-terminal tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein