UniProt UniProt http://www.uniprot.org Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. J. Biol. Chem. (0021-9258) 2001 imex curation Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com 16-Oct-2008: Contacted by JYOTI. human testis cDNA orchard Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. human testis cDNA J. Biol. Chem. (0021-9258) 2001 orchard Only protein-protein interactions imex curation Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. J. Biol. Chem. (0021-9258) 2001 imex curation Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com 16-Oct-2008: Contacted by JYOTI. human testis cDNA orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. human testis cDNA J. Biol. Chem. (0021-9258) 2001 orchard Only protein-protein interactions imex curation Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. J. Biol. Chem. (0021-9258) 2001 imex curation Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com 16-Oct-2008: Contacted by JYOTI. human testis cDNA orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 gal4 vp16 complement gal4 vp16 complementation karyoplasmic interaction ion strategy KISS mammalian two hybrid gal4 vp16 complement predetermined predetermined participant predetermined Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. human testis cDNA J. Biol. Chem. (0021-9258) 2001 orchard Only protein-protein interactions imex curation Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. J. Biol. Chem. (0021-9258) 2001 imex curation Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com 16-Oct-2008: Contacted by JYOTI. human testis cDNA orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. human testis cDNA J. Biol. Chem. (0021-9258) 2001 orchard Only protein-protein interactions imex curation Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. Pex19p dampens the p19ARF-p53-p21WAF1 tumor suppressor pathway. J. Biol. Chem. (0021-9258) 2001 imex curation Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com 16-Oct-2008: Contacted by JYOTI. human testis cDNA orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sugihara T., Kaul SC., Kato J., Reddel RR., Nomura H., Wadhwa R. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Cdkn2a inferred from sequence length. renu@cimmed.com Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. human testis cDNA J. Biol. Chem. (0021-9258) 2001 orchard Only protein-protein interactions imex curation pex19_mouse Peroxisomal biogenesis factor 19 Pex19 Pxf Peroxisomal farnesylated protein Peroxin-19 protein protein mouse Mus musculus Mouse MAAAEEGCGVGVEDDRELEELLESALDDFDKAKPSPEHAPTISAPDASGPQKRAPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLSGLAKNATELQNSGMSEEELMKAMEGLGMDEGDGEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVMVKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDLDALNLSGPPGANGEQCLIM 530A3A0C29370E51 q64364-1 Tumor suppressor ARF p19ARF Cdkn2a p19ARF Alternative reading frame Cyclin-dependent kinase inhibitor 2A protein protein mouse Mus musculus Mouse MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSAGRLPGHAGGAARVRGSAGCARCLGSPAARLGPRAGTSRHRAIFAFRWVLFVFRWVVFVYRWERRPDRRA 644505EFE1CBF478 pex19_human Peroxisomal biogenesis factor 19 PEX19 HK33 PXF OK/SW-cl.22 Peroxin-19 Peroxisomal farnesylated protein 33 kDa housekeeping protein protein protein human Homo sapiens Human MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM 399AF6B79F219100 cdkn2a-pex19 5 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association no figure We isolated a 33-kDa protein, Pex19p/HK33/HsPXF, as a p19ARF-binding protein in a yeast two-hybrid screen cdkn2a-pex19-1 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A Pex19p, either full-length or carboxyl- but not amino-terminal, strongly activated the beta -galactosidase reporter, indicating that it is the carboxyl terminus of p19ARF that interacts with Pex1p (Fig. 1A). cdkn2a-pex19-2 3 6 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 1B Pex19p and p19ARF interacted strongly in a mammalian two-hybrid assay (Fig. 1B). cdkn2a-pex19-3 4 6 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C cdkn2a-pex19-4 1 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2A Most notably, cells expressing both p19ARF-myc and GFP-Pex19p showed p19ARF in the cytoplasm in more than 90% of cells (Fig. 2A, d) where it colocalized with Pex19p (Fig. 2A, d-f)