IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Disruption of the CED-9.CED-4 complex by EGL-1 is a critical step for programmed cell death in Caenorhabditis elegans. Disruption of the CED-9.CED-4 complex by EGL-1 is a critical step for programmed cell death in Caenorhabditis elegans. J. Biol. Chem. (0021-9258) 2000 imex curation del Peso L., Gonzalez VM., Inohara N., Ellis RE., Nunez G. Apoptosis - Interactions involving proteins with a function related to apoptosis Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western del Peso L., Gonzalez VM., Inohara N., Ellis RE., Nunez G. Apoptosis - Interactions involving proteins with a function related to apoptosis J. Biol. Chem. (0021-9258) 2000 IMEx Disruption of the CED-9.CED-4 complex by EGL-1 is a critical step for programmed cell death in Caenorhabditis elegans. Disruption of the CED-9.CED-4 complex by EGL-1 is a critical step for programmed cell death in Caenorhabditis elegans. J. Biol. Chem. (0021-9258) 2000 imex curation del Peso L., Gonzalez VM., Inohara N., Ellis RE., Nunez G. Apoptosis - Interactions involving proteins with a function related to apoptosis Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging anti tag western anti tag western blot anti tag western del Peso L., Gonzalez VM., Inohara N., Ellis RE., Nunez G. Apoptosis - Interactions involving proteins with a function related to apoptosis J. Biol. Chem. (0021-9258) 2000 IMEx Disruption of the CED-9.CED-4 complex by EGL-1 is a critical step for programmed cell death in Caenorhabditis elegans. Disruption of the CED-9.CED-4 complex by EGL-1 is a critical step for programmed cell death in Caenorhabditis elegans. J. Biol. Chem. (0021-9258) 2000 imex curation del Peso L., Gonzalez VM., Inohara N., Ellis RE., Nunez G. Apoptosis - Interactions involving proteins with a function related to apoptosis Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra del Peso L., Gonzalez VM., Inohara N., Ellis RE., Nunez G. Apoptosis - Interactions involving proteins with a function related to apoptosis J. Biol. Chem. (0021-9258) 2000 IMEx ced4_caeel Cell death protein 4 ced-4 C35D10.9 protein protein caeel Caenorhabditis elegans MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTRLERIANFLRIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLARVVSDTDDSHSITDFINRVLSRSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTIANGISILEQRLLEIGNNNVSVPERHIPSHFQKFRRSSASEMYPKTTEETVIRPEDFPKFMQLHQKFYDSLKNFACC DIP protein P30429 original sequence version: 124 6BE9893946B79E6C egl1_caeel Programmed cell death activator egl-1 Egg-laying defective protein 1 egl-1 F23B12.9 protein protein caeel Caenorhabditis elegans MLMLTFASTSSDLLPMSNVFDVQSSVFYNEKNMFYSSSQDFSSCEDSSQFADDSGFFDDSEISSIGYEIGSKLAAMCDDFDAQMMSYSAHASDRSLFHRLLDFFAF 2329D2DB0F019636 ced9_caeel Apoptosis regulator ced-9 Cell death protein 9 ced-9 T07C4.8 protein protein caeel Caenorhabditis elegans MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK DIP protein P41958 original sequence version: 125 DIP protein P41958 original sequence version: 83 7603675E490DD3EB ced_9-egl_1-1 1 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P41958:p.Gly169Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G E Wed May 02 14:46:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly169glu' Tue Jun 30 16:57:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly169Glu' physical association physical association Fig. 1B ced_9g169e-egl_1-1 3 6 unspecified role unspecified role prey prey 35s methionine radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P41958:p.Gly169Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G E Wed May 02 15:17:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly169glu' Tue Jun 30 19:25:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly169Glu' 5 unspecified role unspecified role bait bait 35s methionine tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The ced-9 (Gly169Glu) mutant displays reduced binding affinty for the egl-1 protein compared to the wild type ced-9 protein ced_9-ced_4-2 1 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2A The association between wild type ced-9 and ced-4 proteins is disrupted in the presence of the egl-1 protein. The egl-1 protein did not effect the interaction between mutant ced-9 (G169E) (gly169glu) and wild type ced-4 proteins. ced_4-ced_9-4 1 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P41958:p.Gly169Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G E Wed May 02 19:55:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly169glu' Tue Jun 30 17:36:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly169Glu' 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2B The association between wild type ced-9 and ced-4 proteins is disrupted in the presence of the egl-i protein. The egl-1 protein did not effect the interaction between mutant ced-9 (G169E) (gly169glu) and ced-4 proteins. ced_4-ced_9-2 1 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P41958:p.Gly169Glu mutation mutation certain certain sequence position certain certain certain sequence position certain G E Wed May 02 17:54:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly169glu' Tue Jun 30 17:13:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly169Glu' 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2A The association between wild type ced-9 and ced-4 proteins is disrupted in the presence of the egl-i protein. The egl-1 protein did not effect the interaction between mutant ced-9 (G169E) (gly169glu) and ced-4 proteins. ced_4-ced_9-6 2 6 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P41958:p.Gly169Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G E Wed May 02 18:48:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly169glu' Tue Jun 30 18:00:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly169Glu' 4 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 3B the expression of EGL-1 in the presence of wild type CED-9 changed the CED-4 labeling pattern from granular to diffuse ced_9-egl_1-5 2 5 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P41958:p.Gly169Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G E Wed May 02 15:38:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly169glu' Tue Jun 30 18:16:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly169Glu' colocalization colocalization Fig. 3A