IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes. EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes. Oncogene (0950-9232) 2000 imex curation Li R., Pei H., Watson DK., Papas TS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer 2A No email. Contact: R. Li. CMSB, Room 334, Hollings Cancer Center, Medical University of South Carolina, 86 Jonathan Lucas Street, Charleston, South Carolina, SC 29425 USA. Human fetal brain cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Li R., Pei H., Watson DK., Papas TS. Apoptosis - Interactions involving proteins with a function related to apoptosis 2A No email. Contact: R. Li. CMSB, Room 334, Hollings Cancer Center, Medical University of South Carolina, 86 Jonathan Lucas Street, Charleston, South Carolina, SC 29425 USA. Accepted 2006-MAY-10 by JYOTI. Human fetal brain cDNA library. Oncogene (0950-9232) 2000 Only protein-protein interactions imex curation EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes. EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes. Oncogene (0950-9232) 2000 imex curation Li R., Pei H., Watson DK., Papas TS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer 2A No email. Contact: R. Li. CMSB, Room 334, Hollings Cancer Center, Medical University of South Carolina, 86 Jonathan Lucas Street, Charleston, South Carolina, SC 29425 USA. Human fetal brain cDNA library. Only protein-protein interactions human-dld1 Human colorectal adenocarcinoma dld1 Human colon adenocarcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Li R., Pei H., Watson DK., Papas TS. Apoptosis - Interactions involving proteins with a function related to apoptosis 2A No email. Contact: R. Li. CMSB, Room 334, Hollings Cancer Center, Medical University of South Carolina, 86 Jonathan Lucas Street, Charleston, South Carolina, SC 29425 USA. Accepted 2006-MAY-10 by JYOTI. Human fetal brain cDNA library. Oncogene (0950-9232) 2000 Only protein-protein interactions imex curation EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes. EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes. Oncogene (0950-9232) 2000 imex curation Li R., Pei H., Watson DK., Papas TS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer 2A No email. Contact: R. Li. CMSB, Room 334, Hollings Cancer Center, Medical University of South Carolina, 86 Jonathan Lucas Street, Charleston, South Carolina, SC 29425 USA. Human fetal brain cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li R., Pei H., Watson DK., Papas TS. Apoptosis - Interactions involving proteins with a function related to apoptosis Three overlapping clones were used in a beta galactosidase assay (clones 17, 27 and 30). Assays were performed in triplicate and repeated at least two times. 2A No email. Contact: R. Li. CMSB, Room 334, Hollings Cancer Center, Medical University of South Carolina, 86 Jonathan Lucas Street, Charleston, South Carolina, SC 29425 USA. Accepted 2006-MAY-10 by JYOTI. Human fetal brain cDNA library. Oncogene (0950-9232) 2000 Only protein-protein interactions imex curation EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes. EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes. Oncogene (0950-9232) 2000 imex curation Li R., Pei H., Watson DK., Papas TS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer 2A No email. Contact: R. Li. CMSB, Room 334, Hollings Cancer Center, Medical University of South Carolina, 86 Jonathan Lucas Street, Charleston, South Carolina, SC 29425 USA. Human fetal brain cDNA library. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li R., Pei H., Watson DK., Papas TS. Apoptosis - Interactions involving proteins with a function related to apoptosis 2A No email. Contact: R. Li. CMSB, Room 334, Hollings Cancer Center, Medical University of South Carolina, 86 Jonathan Lucas Street, Charleston, South Carolina, SC 29425 USA. Accepted 2006-MAY-10 by JYOTI. Human fetal brain cDNA library. Oncogene (0950-9232) 2000 Only protein-protein interactions imex curation p14921-1 Protein C-ets-1 ETS1 EWSR2 p54 Ets-1 p51 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE 3B66BCC464B393FB ets1_human Protein C-ets-1 p54 ETS1 EWSR2 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE DIP protein P14921 original sequence version: 175 3B66BCC464B393FB p14921-2 Protein C-ets-1 ETS1 EWSR2 p54 Ets-1 p42 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE 6C3313F2DBE3CF88 q9uer7-1 Death domain-associated protein 6 DAXX BING2 DAP6 Daxx ETS1-associated protein 1 Fas death domain-associated protein protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD DIP protein Q9UER7-1 original sequence version: 105 DIP protein Q9UER7 original sequence version: 125 DIP protein Q9UER7 original sequence version: 155 DIP protein Q9UER7 original sequence version: 124 1B309ADDAA878040 ets1-daxx-1 1 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-913241]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 741-741, sequence length 740 [EBI-913241]647-741 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association ets1-daxx-4 3 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Daxx clone 27 (region 577-740) displayed a much higher beta-galactosidase activity. daxx-ets1-1 4 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction daxx-ets1-2 4 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction ets1-daxx-5 4 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction ets1-daxx-6 4 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction daxx-daxx-2 4 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction ets1-daxx-7 2 8 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization