UniProt UniProt http://www.uniprot.org Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. J. Cell. Sci. (0021-9533) 1999 imex curation Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA J. Cell. Sci. (0021-9533) 1999 jyoti Only protein-protein interactions imex curation Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. J. Cell. Sci. (0021-9533) 1999 imex curation Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA jyoti Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA J. Cell. Sci. (0021-9533) 1999 jyoti Only protein-protein interactions imex curation Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. J. Cell. Sci. (0021-9533) 1999 imex curation Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA J. Cell. Sci. (0021-9533) 1999 jyoti Only protein-protein interactions imex curation Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. J. Cell. Sci. (0021-9533) 1999 imex curation Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA jyoti Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA J. Cell. Sci. (0021-9533) 1999 jyoti Only protein-protein interactions imex curation Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. J. Cell. Sci. (0021-9533) 1999 imex curation Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA jyoti Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA J. Cell. Sci. (0021-9533) 1999 jyoti Only protein-protein interactions imex curation Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies. J. Cell. Sci. (0021-9533) 1999 imex curation Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA jyoti Only protein-protein interactions human-leukocyte Homo sapiens leukocyte Leukocyte (white blood cell) confocal microscopy confocal microscopy immunostaining immunostaining Morris-Desbois C., Bochard V., Reynaud C., Jalinot P. Apoptosis - Interactions involving proteins with a function related to apoptosis pjalinot@ens-lyon.fr Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. EBV-tranformed human B lymphocyte cDNA J. Cell. Sci. (0021-9533) 1999 jyoti Only protein-protein interactions imex curation eif3c_human Eukaryotic translation initiation factor 3 subunit C EIF3C EIF3S8 Eukaryotic translation initiation factor 3 subunit 8 eIF3 p110 protein protein human Homo sapiens Human MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRGGYRQQQSQTAY DIP protein Q99613 original sequence version: 92 DIP protein Q99613 original sequence version: 140 CE5029F4EB51C1AA tri27_human Zinc finger protein RFP TRIM27 RNF76 RFP Ret finger protein Tripartite motif-containing protein 27 RING finger protein 76 RING-type E3 ubiquitin transferase TRIM27 protein protein human Homo sapiens Human MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP 6F963D9048D8A731 pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS DIP protein P29590 original sequence version: 188 DIP protein P29590 original sequence version: 195 DIP protein P29590-1 original sequence version: 187 D50968A977E34287 eif3e_human Eukaryotic translation initiation factor 3 subunit E EIF3E INT6 EIF3S6 Eukaryotic translation initiation factor 3 subunit 6 eIF-3 p48 Viral integration site protein INT-6 homolog protein protein human Homo sapiens Human MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY DIP protein P60228 original sequence version: 120 DIP protein P60228 original sequence version: 60 DIP protein P60228 original sequence version: 76 DIP protein P60228 original sequence version: 111 A5368651DD0DDD0C eif3e-trim27 1 8 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait physical association physical association 4A eif3e-eif3c 1 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 4A eif3e-trim27-1 3 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 4B eif3e-eif3c-1 3 7 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait physical association physical association 4B trim27-eif3e 4 10 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 8 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 5A and 6B eif3e-trim27-2 2 10 unspecified role unspecified role bait bait chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 8 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 5B eif3e-trim27-3 4 8 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 7 eif3e-trim27-4 6 10 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 8 eif3e-trim27-pml 5 9 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 8 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 10 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization 9