IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cloning and characterization of rat BAT3 cDNA. Cloning and characterization of rat BAT3 cDNA. DNA Cell Biol. (1044-5498) 1999 imex curation Ozaki T., Hanaoka E., Naka M., Nakagawara A., Sakiyama S. Apoptosis - Interactions involving proteins with a function related to apoptosis Figure 1 (A). Contact Dr S Sakiyama. Division of Biochemistry, Chiba Cancer Center Research Institute, 666-2 Nitona, Chuoh-ku, Chiba, 260, Japan Rat lung cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ozaki T., Hanaoka E., Naka M., Nakagawara A., Sakiyama S. Apoptosis - Interactions involving proteins with a function related to apoptosis The measured the beta -galactosidase activities (Miller units) of the yeast transformants were measured. Figure 1 (A). Contact Dr S Sakiyama. Division of Biochemistry, Chiba Cancer Center Research Institute, 666-2 Nitona, Chuoh-ku, Chiba, 260, Japan Accepted 2006-JUN-6 by ORCHARD. Rat lung cDNA library. DNA Cell Biol. (1044-5498) 1999 Only protein-protein interactions imex curation Cloning and characterization of rat BAT3 cDNA. Cloning and characterization of rat BAT3 cDNA. DNA Cell Biol. (1044-5498) 1999 imex curation Ozaki T., Hanaoka E., Naka M., Nakagawara A., Sakiyama S. Apoptosis - Interactions involving proteins with a function related to apoptosis Figure 1 (A). Contact Dr S Sakiyama. Division of Biochemistry, Chiba Cancer Center Research Institute, 666-2 Nitona, Chuoh-ku, Chiba, 260, Japan Rat lung cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ozaki T., Hanaoka E., Naka M., Nakagawara A., Sakiyama S. Apoptosis - Interactions involving proteins with a function related to apoptosis Figure 1 (A). Contact Dr S Sakiyama. Division of Biochemistry, Chiba Cancer Center Research Institute, 666-2 Nitona, Chuoh-ku, Chiba, 260, Japan Accepted 2006-JUN-6 by ORCHARD. Rat lung cDNA library. DNA Cell Biol. (1044-5498) 1999 Only protein-protein interactions imex curation bag6_rat Large proline-rich protein BAG6 Bag6 HLA-B-associated transcript 3 Bat3 BCL2-associated athanogene 6 protein protein rat Rattus norvegicus (Rat) Rat MEPSDSTSTAMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQDYNVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGGPLPGTRGPGASGHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMECRGGTQAQASQPPPQTPTVASETVALNSQTSEPVESEAPPREPMESEEMEERPPTQTPELPPSGPAPAGPAPAPETNAPNHPSPAEHVEVLQELQRLQRRLQPFLQRYCEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGARPPPAPGAEAASPGSGQASSLPPSSATVDSSTEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGAQPGGVPSAPTGPLGPPGHGQSLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGALQGAGLGTNTSLAQMVSGLVGQLLMQPVLVAQGTPGMAPASASAPATAQAQAPAPAPAPAPAPATASASAGTTNTATTAGPAPGGPAQPPPPQPSAADLQFSQLLGNLLGPAGPGAGGPSLASPTITVAVPGVPAFLQGMTEFLQASQAAPPPPPPPPPPPPAPEQQTTPPPGSPSGGTASPGGLGPESLPPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTSSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRIGDPPQALPEEPMEVQGAERTSPEPQREDASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASADAEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAHRAFADDP 9CAA4CD9C04F3C29 nbl1_rat Neuroblastoma suppressor of tumorigenicity 1 Nbl1 Dan Zinc finger protein DAN N03 protein protein rat Rattus norvegicus (Rat) Rat MLWVLVGTVLPVMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYMQGEDGPGSQPGSHSHSHPHPGCQTPEPEEPPGAPQVEEEGAED 4786AF6DC3510212 nbl1-bat3 2 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait physical association physical association nbl1-bat3-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association