MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. Cell Death Differ. (1350-9047) 1999 Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer 2 nakajima.mco@dent.tmd.ac.jp A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis 2 nakajima.mco@dent.tmd.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used Cell Death Differ. (1350-9047) 1999 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. Cell Death Differ. (1350-9047) 1999 Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer 2 nakajima.mco@dent.tmd.ac.jp A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis 2 nakajima.mco@dent.tmd.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used Cell Death Differ. (1350-9047) 1999 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. Cell Death Differ. (1350-9047) 1999 Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer 2 nakajima.mco@dent.tmd.ac.jp A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis 2 nakajima.mco@dent.tmd.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used Cell Death Differ. (1350-9047) 1999 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. Cell Death Differ. (1350-9047) 1999 Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer 2 nakajima.mco@dent.tmd.ac.jp A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis 2 nakajima.mco@dent.tmd.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used Cell Death Differ. (1350-9047) 1999 e1bs_ade02 E1B protein, small T-antigen E1B E1B 19 kDa protein E1B-175R protein protein ade02 Human adenovirus C serotype 2 (HAdV-2) Human adenovirus 2 HAdV-2 MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQEQSPWNPRAGLDPRE 2FF4279D0CC700B6 bnip3_human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 BNIP3 NIP3 protein protein human Homo sapiens Human MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF DIP protein Q12983 original sequence version: 136 53967696EDA005E2 53967696EDA005E2 p02545-2 Prelamin-A/C Lamin C LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHVSGSRR CFF0FE0F230FCDE2 p02545-1 Prelamin-A/C Lamin A LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM DIP protein P02545-1 original sequence version: 207 DIP protein P02545 original sequence version: 211 DIP protein P02545 original sequence version: 159 E0855F7699F0318B bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E bni3l_human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like NIP3-like protein X BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A Adenovirus E1B19K-binding protein B5 BNIP3L BNIP3A BNIP3H NIX protein protein human Homo sapiens Human MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY DIP protein O60238 original sequence version: 126 19372E897BC63609 bnip2_human BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 BNIP2 NIP2 protein protein human Homo sapiens Human MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ 0A3CEC636569DD2F bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB e1b19k-lamin_a-1 3 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association e1b19k-lamin_c-1 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association e1b19k-bak-1 3 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association e1b19k-nip2-1 3 11 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association e1b19k-nip3-1 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association e1b19k-b5-1 3 10 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association b5-nip2-1 1 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association b5-nip3-1 1 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association b5-b5-1 1 10 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association b5-lamin_c-1 1 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association b5-e1b19k-1 1 10 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association bcl_2-nip2-1 1 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association bcl_2-nip3-1 1 12 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association b5-e1b19k-2 1 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association b5-b5-2 1 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association b5-nip3-2 1 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association b5-b5-3 1 10 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis less-than less-than greater-than greater-than physical association physical association b5-nip3-3 1 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis less-than less-than greater-than greater-than 6 unspecified role unspecified role prey prey physical association physical association b5-e1b19k-3 1 10 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey undefined mutation D to Y mutation of aa 82 mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:26:36 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'region' physical association physical association b5-b5-4 2 10 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association b5-nip3-4 2 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association e1b19k-b5-2 2 10 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association e1b19k-nip3-2 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association b5-b5-5 4 10 unspecified role unspecified role prey prey c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association b5-b5-6 4 10 unspecified role unspecified role prey prey c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-850158]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 220-220, sequence length 219 [EBI-850158]121-220 10 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-850156]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 220-220, sequence length 219 [EBI-850156]121-220 physical association physical association b5-nip3-5 4 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association nip3-nip3-1 4 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association