IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1. RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1. EMBO J. (0261-4189) 1999 imex curation Garcia E., Marcos-Gutierrez C., del Mar Lorente M., Moreno JC., Vidal M. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation E12.5 embryo extract used for immunoprecipitations. mvidal@cib.csic.es 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Garcia E., Marcos-Gutierrez C., del Mar Lorente M., Moreno JC., Vidal M. Apoptosis - Interactions involving proteins with a function related to apoptosis E12.5 embryo extract used for immunoprecipitations. mvidal@cib.csic.es Accepted 2006-JUL-13 by ORCHARD. 14-DEC-2006: Contacted by JYOTI. Library of E11.5 day mouse embryos cDNA was used. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1. RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1. EMBO J. (0261-4189) 1999 imex curation Garcia E., Marcos-Gutierrez C., del Mar Lorente M., Moreno JC., Vidal M. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation E12.5 embryo extract used for immunoprecipitations. mvidal@cib.csic.es 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Garcia E., Marcos-Gutierrez C., del Mar Lorente M., Moreno JC., Vidal M. Apoptosis - Interactions involving proteins with a function related to apoptosis E12.5 embryo extract used for immunoprecipitations. mvidal@cib.csic.es Accepted 2006-JUL-13 by ORCHARD. 14-DEC-2006: Contacted by JYOTI. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1. RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1. EMBO J. (0261-4189) 1999 imex curation Garcia E., Marcos-Gutierrez C., del Mar Lorente M., Moreno JC., Vidal M. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation E12.5 embryo extract used for immunoprecipitations. mvidal@cib.csic.es 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions mouse-embryo Mus musculus embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Garcia E., Marcos-Gutierrez C., del Mar Lorente M., Moreno JC., Vidal M. Apoptosis - Interactions involving proteins with a function related to apoptosis E12.5 embryo extract used for immunoprecipitations. mvidal@cib.csic.es Accepted 2006-JUL-13 by ORCHARD. 14-DEC-2006: Contacted by JYOTI. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1. RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1. EMBO J. (0261-4189) 1999 imex curation Garcia E., Marcos-Gutierrez C., del Mar Lorente M., Moreno JC., Vidal M. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation E12.5 embryo extract used for immunoprecipitations. mvidal@cib.csic.es 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Garcia E., Marcos-Gutierrez C., del Mar Lorente M., Moreno JC., Vidal M. Apoptosis - Interactions involving proteins with a function related to apoptosis E12.5 embryo extract used for immunoprecipitations. mvidal@cib.csic.es Accepted 2006-JUL-13 by ORCHARD. 14-DEC-2006: Contacted by JYOTI. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation ring2_mouse E3 ubiquitin-protein ligase RING2 Rnf2 DinG Ring1b RING finger protein 2 RING finger protein 1B RING-type E3 ubiquitin transferase RING2 protein protein mouse Mus musculus Mouse MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q9CQJ4 original sequence version: 124 DIP protein Q9CQJ4 original sequence version: 115 84BA5B3E044DB7EC cbx2_mouse Chromobox protein homolog 2 Cbx2 M33 Modifier 3 protein protein protein mouse Mus musculus Mouse MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKHTVTSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEEDDSDLDSKRGPRGRETHPVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKAARRPVSLAKVLKTTRKDLGTSAAKLPPPLSAPVAGLAALKAHTKEACGGPSTMATPENLASLMKGMAGSPSRGGIWQSSIVHYMNRMSQSQVQAASRLALKAQATNKCGLGLDLKVRTQKGGELGGSPAGGKVPKAPGGGAAEQQRGNHSGSPGAQLAPTQELSLQVLDLQSVKNGVPGVGLLARHAPAKAIPATNPATGKGPGSGPTGANMTNAPTDNNKGEKLTCKATALPAPSVKRDTVKSVAASGGQEGHTAPGEGRKPPALSELSTGEENSSSDSDPDSTSLPSAAQNLSVAIQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY DIP protein P30658 original sequence version: 76 F89EF3CEF14ACA72 rybp_mouse RING1 and YY1-binding protein Rybp Dedaf Death effector domain-associated factor protein protein mouse Mus musculus Mouse MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQYATPPPPKKEKKEKVEKPDKEKPEKDKDISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF 80E4D647244E213D ring1_mouse E3 ubiquitin-protein ligase RING1 Ring1 Ring1A Rnf1 RING finger protein 1 Polycomb complex protein RING1 Transcription repressor Ring1A RING-type E3 ubiquitin transferase RING1 protein protein mouse Mus musculus Mouse MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPMPGSDQTATMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGAGAGASSVGTGGGAAGGACGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQETTEPGGPGGGASDTGGPDGGGGERGVAGGGEGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK 4F274E976974A2D8 pho_drome Polycomb protein PHO pho CG17743 Protein pleiohomeotic Transcription factor YY1 homolog protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAYERFGIILQSEQYDEDIGNTKVNQKMNEGNHYDLHRKNAFDRIIHSESKKGDNVINYNIHENDKIKAADNIFSSKLKMNPNMSYEMNINCFKNIGYGENQETSKVLTNSLSNNDINTEESGVVDKNSPFLTLGTTILNSNGKSRRWEQKLVHIKTMEGEFSVTMWASGISDDEYSGSDQIVGASDLLKGKEEFGIDGFTSQQNKEYQKMESKFTNAQTLEMPHPISSVQIMDHLIKERGNLSQENNISERILSKTTLSFEEPILLPDSSSIELVNETAAMTINNHRTLSNHTGNTGDLHALPSSVPFRIGLHEGQVNDCLSTISQSTHQDNTDSTGCGEMNLSEVTVSYTNDKKIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKRNTSISGKSGCSNAESNSQSEDTSANYVKVELQDSVTENHVPFVVYAD 95E729571C5194E1 tyy1_human Transcriptional repressor protein YY1 Yin and yang 1 Delta transcription factor NF-E1 YY1 INO80S INO80 complex subunit S protein protein human Homo sapiens Human MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ DIP protein P25490 original sequence version: 153 058C05A0AD2D04E6 rnf2-rybp 3 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2 We have identified a new Zn finger protein, RYBP, which interacts directly with both Ring1 proteins (Ring1A and Ring1B) and with M33, two mutually interacting sets of proteins of the mammalian Polycomb complex. ring1-rybp-2 3 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2 Ring1 binds RYBP and M33 through the same C-terminal domain, whereas the RYBP-M33 interaction takes place through an M33 domain not involved in Ring1 binding. ring1-rybp-1 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association The Ring1A protein AA 1and 2 did not correspond to amino acids 24 and 25 of the entry. rnf2-rybp-1 3 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 2 We have identified a new Zn finger protein, RYBP, which interacts directly with both Ring1 proteins (Ring1A and Ring1B) and with M33, two mutually interacting sets of proteins of the mammalian Polycomb complex. ring1-rybp-3 2 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role bait bait n terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4, 7 Ring1 binds RYBP and M33 through the same C-terminal domain, whereas the RYBP-M33 interaction takes place through an M33 domain not involved in Ring1 binding. cbx2-rybp 2 7 unspecified role unspecified role bait bait n terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction 5B, 5C Ring1 binds RYBP and M33 through the same C-terminal domain, whereas the RYBP-M33 interaction takes place through an M33 domain not involved in Ring1 binding. yy1-rybp 2 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Two independent sites AA42-118 and AA207-227 of Rybp are involved in this interaction 7 cbx2-rybp-1 4 7 unspecified role unspecified role bait bait n terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey n terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 5A Ring1 binds RYBP and M33 through the same C-terminal domain, whereas the RYBP-M33 interaction takes place through an M33 domain not involved in Ring1 binding. yy1-rybp-1 4 7 unspecified role unspecified role bait bait n terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 pho-rybp 4 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait n terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association The aminoacid numbering for the drosophila PHO protein is as described by the authors. The UniProtKB entry is longer. 6 cbx2-ring1 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4 Ring1 binds RYBP and M33 through the same C-terminal domain, whereas the RYBP-M33 interaction takes place through an M33 domain not involved in Ring1 binding. cbx2-rybp-2 2 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait n terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 7 Ring1 binds RYBP and M33 through the same C-terminal domain, whereas the RYBP-M33 interaction takes place through an M33 domain not involved in Ring1 binding. Two binding domains 42-118 and 207-227 are involved in Rybp and Cbx2 interaction.