MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. Mol. Cell (1097-2765) 1999 Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa cell library yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis This experiment relates to a negative interaction. HeLa cell library Mol. Cell (1097-2765) 1999 The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. Mol. Cell (1097-2765) 1999 Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa cell library human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis The source organism for bim sequence is not stated but assumed to be mouse as in previous experiments from the same paper. This experiment is related to a negative interaction no HeLa cell library Mol. Cell (1097-2765) 1999 o54918-3 Bcl-2-like protein 11 Bcl2l11 Bim Bcl2-interacting mediator of cell death protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH DIP protein O54918-3 original sequence version: 57 67AB421AC1E4D2CA dlrb1_human Dynein light chain roadblock-type 1 DYNLRB1 BITH DNLC2A HSPC162 Dynein light chain 2A, cytoplasmic Dynein-associated protein Km23 Bithoraxoid-like protein DNCL2A ROBLD1 Roadblock domain-containing protein 1 protein protein human Homo sapiens Human MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE AAE1EFCD372897B3 bims-dncl2a-1 1 3 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association true dncl2a-bims-2 2 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association true bims-dncl2a-2 2 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association true