IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Tissue kallikrein is required for the cardioprotective effect of Cyclosporin A in myocardial ischemia in the mouse. Tissue kallikrein is required for the cardioprotective effect of Cyclosporin A in myocardial ischemia in the mouse. Biochemical pharmacology 2015 imex curation Youcef G., Belaidi E., Waeckel L., Fazal L., Clemessy M., Vincent MP., Zadigue G., Richer C., Alhenc-Gelas F., Ovize M., Pizard A. Cardiac - Interactions involving cardiac related proteins Affinomics - Interactions curated for the Affinomics consortium. anne.pizard@inserm.fr Only protein-protein interactions imex curation rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Youcef G., Belaidi E., Waeckel L., Fazal L., Clemessy M., Vincent MP., Zadigue G., Richer C., Alhenc-Gelas F., Ovize M., Pizard A. Cardiac - Interactions involving cardiac related proteins The molecule "VDAC" was determined to be VDAC1 from the antibody suppliers site. anne.pizard@inserm.fr Accepted 2015-APR-08 by ORCHARD Biochemical pharmacology 2015 Only protein-protein interactions imex curation imex curation ppif_rat Peptidyl-prolyl cis-trans isomerase F, mitochondrial Cyclophilin D Ppif Cyclophilin F Rotamase F protein protein rat Rattus norvegicus (Rat) Rat MLALRCGPRLLGLLSGPRSAPLLLSTTRTCSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS 69048482631B9FAD vdac1_rat Voltage-dependent anion-selective channel protein 1 Vdac1 Outer mitochondrial membrane protein porin 1 protein protein rat Rattus norvegicus (Rat) Rat MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA DIP protein Q9Z2L0 original sequence version: 87 D32B05B8A8D75732 p08934-pro_0000006697 Bradykinin Kng1 Kng protein protein rat Rattus norvegicus (Rat) Rat RPPGFSPFR 381 389 3393D775B9C86777 klk1_rat Kallikrein-1 Gamma-NGF Nerve growth factor gamma chain PS kallikrein Pancreatic kallikrein RGK-1 Tissue kallikrein True tissue kallikrein Ngfg Klk-1 Klk1 protein protein rat Rattus norvegicus (Rat) Rat MWFLILFLALSLGRNDAAPPVQSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGVLIDPSWVITAAHCATDNYQVWLGRNNLYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADITDGVKVIDLPIEEPKVGSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLICNGVLQGITSWGFNPCGEPKKPGIYTKLIKFTPWIKEVMKENP F2F99C0227A7882B tom22_rat Mitochondrial import receptor subunit TOM22 homolog Tomm22 Translocase of outer membrane 22 kDa subunit homolog Tom22 protein protein rat Rattus norvegicus (Rat) Rat MAAAVAAAGAGEPLSPEELVPKAEAEKAEEDLEEDDDDELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPPLPGKI C1259302C15CA3AB kng1-vdac1-2 1 3 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3B-1 kng1-tomm22-1 1 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3B-2 ngfg-ppif-1 1 2 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3B-3 kng1-ppif-1 1 2 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3B-4