IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Lipid rafts are required for signal transduction by angiotensin II receptor type 1 in neonatal glomerular mesangial cells. Lipid rafts are required for signal transduction by angiotensin II receptor type 1 in neonatal glomerular mesangial cells. Exp. Cell Res. (0014-4827) 2014 imex curation Adebiyi A., Soni H., John T.A., Yang F. Affinomics - Interactions curated for the Affinomics consortium. aadebiyi@uthsc.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions pig-kidney-mesangial_cell Sus scrofa kidney-mesangial_cell kidney-mesangial_cell mesangial cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Adebiyi A., Soni H., John T.A., Yang F. Affinomics - Interactions curated for the Affinomics consortium. neonatal glomerular mesangial cells aadebiyi@uthsc.edu Accepted 2014-DEC-17 by ORCHARD Exp. Cell Res. (0014-4827) 2014 Only protein-protein interactions imex curation Lipid rafts are required for signal transduction by angiotensin II receptor type 1 in neonatal glomerular mesangial cells. Lipid rafts are required for signal transduction by angiotensin II receptor type 1 in neonatal glomerular mesangial cells. Exp. Cell Res. (0014-4827) 2014 imex curation Adebiyi A., Soni H., John T.A., Yang F. Affinomics - Interactions curated for the Affinomics consortium. aadebiyi@uthsc.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions pig-kidney-mesangial_cell Sus scrofa kidney-mesangial_cell kidney-mesangial_cell mesangial cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Adebiyi A., Soni H., John T.A., Yang F. Affinomics - Interactions curated for the Affinomics consortium. neonatal glomerular mesangial cells aadebiyi@uthsc.edu Accepted 2014-DEC-17 by ORCHARD Exp. Cell Res. (0014-4827) 2014 Only protein-protein interactions imex curation cav1_pig Caveolin-1 CAV1 protein protein pig Sus scrofa (Pig) Pig MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRINMQKEI 1A67CE55F431A3BF agtr1_pig Type-1 angiotensin II receptor AGTR1 Angiotensin II type-1 receptor protein protein pig Sus scrofa (Pig) Pig MILNSSTEDSIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVCAFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKIADIVDTAMPITICLAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSENGSSSTKKSAPCTEVE D5B93968CC57ABF0 agtr1-cav1 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 6C agtr1-cav1-1 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6D