IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Frizzled10 mediates WNT1 and WNT3A signaling in the dorsal spinal cord of the developing chick embryo. Frizzled10 mediates WNT1 and WNT3A signaling in the dorsal spinal cord of the developing chick embryo. Dev. Dyn. (1058-8388) 2014 imex curation Galli L.M., Munji R.N., Chapman S.C., Easton A., Li L., Onguka O., Ramahi J.S., Suriben R., Szabo L.A., Teng C., Tran B., Hannoush R.N., Burrus L.W. Affinomics - Interactions curated for the Affinomics consortium. LBurrus@sfsu.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Galli L.M., Munji R.N., Chapman S.C., Easton A., Li L., Onguka O., Ramahi J.S., Suriben R., Szabo L.A., Teng C., Tran B., Hannoush R.N., Burrus L.W. Affinomics - Interactions curated for the Affinomics consortium. LBurrus@sfsu.edu Accepted 2014-DEC-04 by ORCHARD Dev. Dyn. (1058-8388) 2014 Only protein-protein interactions imex curation Frizzled10 mediates WNT1 and WNT3A signaling in the dorsal spinal cord of the developing chick embryo. Frizzled10 mediates WNT1 and WNT3A signaling in the dorsal spinal cord of the developing chick embryo. Dev. Dyn. (1058-8388) 2014 imex curation Galli L.M., Munji R.N., Chapman S.C., Easton A., Li L., Onguka O., Ramahi J.S., Suriben R., Szabo L.A., Teng C., Tran B., Hannoush R.N., Burrus L.W. Affinomics - Interactions curated for the Affinomics consortium. LBurrus@sfsu.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Galli L.M., Munji R.N., Chapman S.C., Easton A., Li L., Onguka O., Ramahi J.S., Suriben R., Szabo L.A., Teng C., Tran B., Hannoush R.N., Burrus L.W. Affinomics - Interactions curated for the Affinomics consortium. LBurrus@sfsu.edu Accepted 2014-DEC-04 by ORCHARD Dev. Dyn. (1058-8388) 2014 Only protein-protein interactions imex curation wnt3a_chick Protein Wnt-3a WNT3A protein protein chick Gallus gallus (Chicken) Chicken MASFGYFLFLCGLSQALSSYPIWWSLAIGHQYSSLGTQPILCGSIPGLVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQFRGRRWNCTTVNDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSATICGCDTRHKGSPGEGWKWGGCSEDVEFGSMVSREFADARENRPDARSAMNRHNNEAGRTSIIELMHLKCKCHGLSGSCEVKTCWWSQPDFRVIGDYLKDKYDSASEMVVEKHRESRGWVETLRPKYNFFKAPTEKDLVYYENSPNFCEPNPETGSFGTRDRICNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVRCQECIRVYDVHTCK EE558AC4B2225B3A fzd10_chick Frizzled-10 FZD10 FZ10 protein protein chick Gallus gallus (Chicken) Chicken MGPAAGNLVRAVLALCWLAEHCAGISSIDIERPGDGRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPPRGSSMLPPMFRPQRPSTGHDLQQHKDSLSRTSCENPGKFHHVEKSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTFLIDPQRFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIACDRDSGQLYVIQEGLESTGCTIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVASQQKCKMNNQTKNLDCMMNNSIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVCSRRLKKRSRRKPASVITSSGIYKKPQHPQKTHLAKYESTLQPPTCV 3E2A7E747CF9EE4B wnt1_chick Protein Wnt-1 WNT1 WNT-1 protein protein chick Gallus gallus (Chicken) Chicken MRGPALLLALRALCALSALRGTARAVNNSGRWWGIINVASSTNLLTDSGSVQLVLEPGLQLLSRKQRRLIRQNPGILHSVSAGLQSAVRECQWQFRNRRWNCPTSQGPNIFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSSEKGRDLRFLMNLHNNEAGRMTVFSEMRQECKCHGMSGSCTVRTCWMRLPTFRAVGDVLKDRFDGASRVIYGNKGSNRASRVELHHLEPENPAHKPPSPHDLVYFEKSPNFCTYSGKMGTAGTAGRACNSSSPGLDGCELLCCGRGFRTRTQRVTERCNCTFHWCCHVSCLNCTNTQVLHECL F1D7A6C5EFB44C2B fzd10-wnt3a 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4/5 LRP6 (a member of the low density lipoprotein receptor family.) fzd10-wnt3a-1 2 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4i fzd10-wnt3a-2 1 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association 4i fzd10-wnt3a-2 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association 4 LRP6 (a member of the low density lipoprotein receptor family.)