IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ L-DOPA-treatment in primates disrupts the expression of A(2A) adenosine-CB(1) cannabinoid-D(2) dopamine receptor heteromers in the caudate nucleus. L-DOPA-treatment in primates disrupts the expression of A(2A) adenosine-CB(1) cannabinoid-D(2) dopamine receptor heteromers in the caudate nucleus. Neuropharmacology (0028-3908) 2014 imex curation Bonaventura J., Rico A.J., Moreno E., Sierra S., Sánchez M., Luquin N., Farré D., Müller C.E., Martínez-Pinilla E., Cortés A., Mallol J., Armentero M.T., Pinna A., Canela E.I., Lluís C., McCormick P.J., Lanciego J.L., Casadó V., Franco R. Affinomics - Interactions curated for the Affinomics consortium. not even attempted to add the competition expts - we dont know what dopamine is binding to as there are several types of dopamine receptor. (membrane suspensions used). I had thought that YM-09151-2 radioligand might be being specific for the D2 receptor, but - see below:- PMID: 19540292 states:- YM-09151-2 labels also the sigma and serotonin receptors of type 1a and 2a....since [3H]-YM-09151-2 binds to sigma receptors with a high affinity.... [3H]-YM-09151-2 could not distinguish between the D2/D3 and D4 receptors. On that basis I have not added any of these ligand studies.(let me know if you disagree!) Radioligand studies have not been included as the specificities of ligand(s) binding is not known. rfranco123@gmail.com,vcasado@ub.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions macfa-brain_striatum M. fascicularis striatum brain_striatum Brain striatum, Neostratum. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Bonaventura J., Rico A.J., Moreno E., Sierra S., Sánchez M., Luquin N., Farré D., Müller C.E., Martínez-Pinilla E., Cortés A., Mallol J., Armentero M.T., Pinna A., Canela E.I., Lluís C., McCormick P.J., Lanciego J.L., Casadó V., Franco R. Affinomics - Interactions curated for the Affinomics consortium. not even attempted to add the competition expts - we dont know what dopamine is binding to as there are several types of dopamine receptor. (membrane suspensions used). I had thought that YM-09151-2 radioligand might be being specific for the D2 receptor, but - see below:- PMID: 19540292 states:- YM-09151-2 labels also the sigma and serotonin receptors of type 1a and 2a....since [3H]-YM-09151-2 binds to sigma receptors with a high affinity.... [3H]-YM-09151-2 could not distinguish between the D2/D3 and D4 receptors. On that basis I have not added any of these ligand studies.(let me know if you disagree!) Radioligand studies have not been included as the specificities of ligand(s) binding is not known. rfranco123@gmail.com,vcasado@ub.edu Accepted 2014-OCT-23 by ORCHARD Neuropharmacology (0028-3908) 2014 imex curation f7cyh8_macmu D(2) dopamine receptor DRD2 Dopamine D2 receptor protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRSHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKNHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 5270650F89B7C286 g7p3k6_macfa Cannabinoid receptor 1 EGM_13830 protein protein macfa Macaca fascicularis (Crab-eating macaque) Cynomolgus monkey MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL 1D2E49061D12ABF2 f6x9c0_macmu Adenosine receptor A2 ADORA2A protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCNHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSTQESQGNTSLPDVELLSHELKGVCPEPPGLDDPLAQGGAGVS 9128C70EEA4BE6CC drd2-g7n3f5 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1,4,5 The number of positive cells (receptor heteromers) was significantly reduced in Putamen slices compared with the caudate nucleus. The expression of heteromers was reduced in caudate nucleus slices from l-DOPA treated monkeys as compared with control and monkeys with induced Parkinsons Disease. drd2-g7n3f5-1 1 2 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1,4,5 The number of positive cells (receptor heteromers) was significantly reduced in Putamen slices compared with the caudate nucleus. The expression of heteromers was reduced in caudate nucleus slices from l-DOPA treated monkeys as compared with control and monkeys with induced Parkinsons Disease. drd2-g7n3f5-2 1 3 unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1,4,5 The number of positive cells (receptor heteromers) was significantly reduced in Putamen slices compared with the caudate nucleus. The expression of heteromers was reduced in caudate nucleus slices from l-DOPA treated monkeys as compared with control and monkeys with induced Parkinsons Disease.