IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Analysis of close associations of uropod-associated proteins in human T-cells using the proximity ligation assay. Analysis of close associations of uropod-associated proteins in human T-cells using the proximity ligation assay. PeerJ 2013 imex curation Baumann T., Affentranger S., Niggli V. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving "P-ERM" have not been included (shown in Figs 2,4 and 5) as the antibody to "P-ERM" is not targetted to a specific protein, detecting phosph-Ezrin,Radixin and Moesin. verena.niggli@pathology.unibe.ch 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Baumann T., Affentranger S., Niggli V. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving "P-ERM" have not been included (shown in Figs 2,4 and 5) as the antibody to "P-ERM" is not targetted to a specific protein, detecting phosph-Ezrin,Radixin and Moesin. verena.niggli@pathology.unibe.ch Accepted 2014-OCT-23 by ORCHARD PeerJ 2013 Only protein-protein interactions imex curation Analysis of close associations of uropod-associated proteins in human T-cells using the proximity ligation assay. Analysis of close associations of uropod-associated proteins in human T-cells using the proximity ligation assay. PeerJ 2013 imex curation Baumann T., Affentranger S., Niggli V. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving "P-ERM" have not been included (shown in Figs 2,4 and 5) as the antibody to "P-ERM" is not targetted to a specific protein, detecting phosph-Ezrin,Radixin and Moesin. verena.niggli@pathology.unibe.ch 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baumann T., Affentranger S., Niggli V. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving "P-ERM" have not been included (shown in Figs 2,4 and 5) as the antibody to "P-ERM" is not targetted to a specific protein, detecting phosph-Ezrin,Radixin and Moesin. verena.niggli@pathology.unibe.ch Accepted 2014-OCT-23 by ORCHARD PeerJ 2013 Only protein-protein interactions imex curation actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 flot2_human Flotillin-2 FLOT2 ESA1 M17S1 Epidermal surface antigen Membrane component chromosome 17 surface marker 1 protein protein human Homo sapiens Human MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV F690BFE0151D3BD7 selpl_human P-selectin glycoprotein ligand 1 SELPLG Selectin P ligand protein protein human Homo sapiens Human MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAASNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP DIP protein Q14242 original sequence version: 93 A92A2A902DC9963A flot1_human Flotillin-1 FLOT1 protein protein human Homo sapiens Human MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA C69E5421E565F53A flot1-flot2-3 1 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 1A Colocalisation was located along the plasma membrane in resting cells, and located at the plasma membrane of the tips of the uropods for the chemokine SDF-1 (Stromal cell derived factor 1) stimulated cells. flot1-flot2-4 2 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1B Colocalisation was located randomly along the plasma membrane in resting cells, and aligned linearly around the entire border of the uropod of the chemokine SDF-1 (Stromal cell derived factor 1) stimulated cells. flot1-flot2-5 1 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 3A Colocalisation was located along the plasma membrane in resting cells, and located at the plasma membrane of the tips of the uropods for the chemokine SDF-1 (Stromal cell derived factor 1) stimulated cells. flot1-flot2-6 2 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3B Colocalisation was located randomly along the plasma membrane in resting cells, and aligned linearly around the entire border of the uropod of the chemokine SDF-1 (Stromal cell derived factor 1) stimulated cells. flot2-selplg 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp fig 1