IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction between optineurin and the bZIP transcription factor NRL. Interaction between optineurin and the bZIP transcription factor NRL. Cell Biol. Int. (1065-6995) 2014 imex curation Wang C., Hosono K., Ohtsubo M., Ohishi K., Gao J., Nakanishi N., Hikoya A., Sato M., Hotta Y., Minoshima S. Affinomics - Interactions curated for the Affinomics consortium. Fig 6 (Rat retina) :- although Fig 6J (especially) looks positive for colocalisation, the text states there is not any....so not added. mino@hama-med.ac.jp 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Wang C., Hosono K., Ohtsubo M., Ohishi K., Gao J., Nakanishi N., Hikoya A., Sato M., Hotta Y., Minoshima S. Affinomics - Interactions curated for the Affinomics consortium. Fig 6 (Rat retina) :- although Fig 6J (especially) looks positive for colocalisation, the text states there is not any....so not added. mino@hama-med.ac.jp Accepted 2014-NOV-19 by ORCHARD Cell Biol. Int. (1065-6995) 2014 Only protein-protein interactions imex curation Interaction between optineurin and the bZIP transcription factor NRL. Interaction between optineurin and the bZIP transcription factor NRL. Cell Biol. Int. (1065-6995) 2014 imex curation Wang C., Hosono K., Ohtsubo M., Ohishi K., Gao J., Nakanishi N., Hikoya A., Sato M., Hotta Y., Minoshima S. Affinomics - Interactions curated for the Affinomics consortium. Fig 6 (Rat retina) :- although Fig 6J (especially) looks positive for colocalisation, the text states there is not any....so not added. mino@hama-med.ac.jp 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang C., Hosono K., Ohtsubo M., Ohishi K., Gao J., Nakanishi N., Hikoya A., Sato M., Hotta Y., Minoshima S. Affinomics - Interactions curated for the Affinomics consortium. Fig 6 (Rat retina) :- although Fig 6J (especially) looks positive for colocalisation, the text states there is not any....so not added. mino@hama-med.ac.jp Accepted 2014-NOV-19 by ORCHARD Cell Biol. Int. (1065-6995) 2014 Only protein-protein interactions imex curation Interaction between optineurin and the bZIP transcription factor NRL. Interaction between optineurin and the bZIP transcription factor NRL. Cell Biol. Int. (1065-6995) 2014 imex curation Wang C., Hosono K., Ohtsubo M., Ohishi K., Gao J., Nakanishi N., Hikoya A., Sato M., Hotta Y., Minoshima S. Affinomics - Interactions curated for the Affinomics consortium. Fig 6 (Rat retina) :- although Fig 6J (especially) looks positive for colocalisation, the text states there is not any....so not added. mino@hama-med.ac.jp 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Wang C., Hosono K., Ohtsubo M., Ohishi K., Gao J., Nakanishi N., Hikoya A., Sato M., Hotta Y., Minoshima S. Affinomics - Interactions curated for the Affinomics consortium. Fig 6 (Rat retina) :- although Fig 6J (especially) looks positive for colocalisation, the text states there is not any....so not added. mino@hama-med.ac.jp Accepted 2014-NOV-19 by ORCHARD Cell Biol. Int. (1065-6995) 2014 Only protein-protein interactions imex curation Interaction between optineurin and the bZIP transcription factor NRL. Interaction between optineurin and the bZIP transcription factor NRL. Cell Biol. Int. (1065-6995) 2014 imex curation Wang C., Hosono K., Ohtsubo M., Ohishi K., Gao J., Nakanishi N., Hikoya A., Sato M., Hotta Y., Minoshima S. Affinomics - Interactions curated for the Affinomics consortium. Fig 6 (Rat retina) :- although Fig 6J (especially) looks positive for colocalisation, the text states there is not any....so not added. mino@hama-med.ac.jp 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang C., Hosono K., Ohtsubo M., Ohishi K., Gao J., Nakanishi N., Hikoya A., Sato M., Hotta Y., Minoshima S. Affinomics - Interactions curated for the Affinomics consortium. Fig 6 (Rat retina) :- although Fig 6J (especially) looks positive for colocalisation, the text states there is not any....so not added. mino@hama-med.ac.jp Accepted 2014-NOV-19 by ORCHARD Cell Biol. Int. (1065-6995) 2014 Only protein-protein interactions imex curation optn_human Optineurin HYPL Optic neuropathy-inducing protein E3-14.7K-interacting protein FIP-2 Huntingtin-interacting protein L Huntingtin yeast partner L NEMO-related protein Transcription factor IIIA-interacting protein OPTN FIP2 GLC1E NRP HIP7 Huntingtin-interacting protein 7 protein protein human Homo sapiens Human MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII DIP protein Q96CV9 original sequence version: 65 2BAF841BA515AAE2 p54845-1 Neural retina-specific leucine zipper protein NRL D14S46E protein protein human Homo sapiens Human MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL CCABEDC1C1123614 nrl-optn 3 6 anti-tag immunocytochemistry anti-tag immunocytochemistry immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 anti-tag immunocytochemistry anti-tag immunocytochemistry immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig 1A nrl-optn-1 3 5 unspecified role unspecified role neutral component neutral component 6 anti-tag immunocytochemistry anti-tag immunocytochemistry immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig 1E optn-nrl 4 5 unspecified role unspecified role bait bait tail_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 anti-tag immunocytochemistry anti-tag immunocytochemistry anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 2A,5 nrl-optn-3 4 6 anti-tag immunocytochemistry anti-tag immunocytochemistry anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 anti-tag immunocytochemistry anti-tag immunocytochemistry anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 2C optn-nrl-1 2 5 unspecified role unspecified role bait bait 6 anti-tag immunocytochemistry anti-tag immunocytochemistry anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 2E nrl-optn-4 1 5 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 anti-tag immunocytochemistry anti-tag immunocytochemistry antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig 3