IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A-type lamins maintain the positional stability of DNA damage repair foci in mammalian nuclei. A-type lamins maintain the positional stability of DNA damage repair foci in mammalian nuclei. PLoS ONE 2013 imex curation Mahen R., Hattori H., Lee M., Sharma P., Jeyasekharan A.D., Venkitaraman A.R. Affinomics - Interactions curated for the Affinomics consortium. arv22@hutchison-mrc.cam.ac.uk 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Mahen R., Hattori H., Lee M., Sharma P., Jeyasekharan A.D., Venkitaraman A.R. Affinomics - Interactions curated for the Affinomics consortium. arv22@hutchison-mrc.cam.ac.uk Accepted 2014-SEP-16 by ORCHARD PLoS ONE 2013 Only protein-protein interactions imex curation A-type lamins maintain the positional stability of DNA damage repair foci in mammalian nuclei. A-type lamins maintain the positional stability of DNA damage repair foci in mammalian nuclei. PLoS ONE 2013 imex curation Mahen R., Hattori H., Lee M., Sharma P., Jeyasekharan A.D., Venkitaraman A.R. Affinomics - Interactions curated for the Affinomics consortium. arv22@hutchison-mrc.cam.ac.uk 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Mahen R., Hattori H., Lee M., Sharma P., Jeyasekharan A.D., Venkitaraman A.R. Affinomics - Interactions curated for the Affinomics consortium. arv22@hutchison-mrc.cam.ac.uk Accepted 2014-SEP-16 by ORCHARD PLoS ONE 2013 Only protein-protein interactions imex curation A-type lamins maintain the positional stability of DNA damage repair foci in mammalian nuclei. A-type lamins maintain the positional stability of DNA damage repair foci in mammalian nuclei. PLoS ONE 2013 imex curation Mahen R., Hattori H., Lee M., Sharma P., Jeyasekharan A.D., Venkitaraman A.R. Affinomics - Interactions curated for the Affinomics consortium. arv22@hutchison-mrc.cam.ac.uk 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mahen R., Hattori H., Lee M., Sharma P., Jeyasekharan A.D., Venkitaraman A.R. Affinomics - Interactions curated for the Affinomics consortium. it does not state which cell line was used here for Fig 3E - but have assumed it was MEFS again, as this is used thoughout Fig 3 unless specified otherwise. If you dont agree I will write to the authors. arv22@hutchison-mrc.cam.ac.uk Accepted 2014-SEP-16 by ORCHARD PLoS ONE 2013 Only protein-protein interactions imex curation A-type lamins maintain the positional stability of DNA damage repair foci in mammalian nuclei. A-type lamins maintain the positional stability of DNA damage repair foci in mammalian nuclei. PLoS ONE 2013 imex curation Mahen R., Hattori H., Lee M., Sharma P., Jeyasekharan A.D., Venkitaraman A.R. Affinomics - Interactions curated for the Affinomics consortium. arv22@hutchison-mrc.cam.ac.uk 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mahen R., Hattori H., Lee M., Sharma P., Jeyasekharan A.D., Venkitaraman A.R. Affinomics - Interactions curated for the Affinomics consortium. arv22@hutchison-mrc.cam.ac.uk Accepted 2014-SEP-16 by ORCHARD PLoS ONE 2013 Only protein-protein interactions imex curation lmna_human Prelamin-A/C LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM E0855F7699F0318B h2ax_mouse Histone H2AX H2ax H2a.x H2afx Hist5-2ax Histone H2A.X protein protein mouse Mus musculus Mouse MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPAVGKKASQASQEY A3683760C13CC2B9 lmna_mouse Prelamin-A/C Lmna Lmn1 protein protein mouse Mus musculus Mouse METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQSQGGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWASGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGEEVAMRKLVRSLTMVEDNEDDDEDGEELLHHHRGSHCSGSGDPAEYNLRSRTVLCGTCGQPADKAAGGAGAQVGGSISSGSSASSVTVTRSFRSVGGSGGGSFGDNLVTRSYLLGNSSPRSQSSQNCSIM DIP protein P48678 original sequence version: 150 5434F574803FCB15 h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY DIP protein P16104 original sequence version: 114 DIP protein P16104 original sequence version: 110 DIP protein P16104 original sequence version: 117 DIP protein P16104 original sequence version: 133 DIP protein P16104 original sequence version: 140 DIP protein P16104 original sequence version: 113 DIP protein P16104 original sequence version: 99 D4683775C2E6C3A9 h2afx-lmna 2 6 unspecified role unspecified role neutral component neutral component possible_phospho_ser140 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3 IR h2afx-lmna-1 1 8 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3Civ IR lmna-h2afx-1 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3Civ DNA damage (unspecified) lmna-h2afx-2 4 8 unspecified role unspecified role prey prey possible_phospho_ser140 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3Civ DNA damage, Adriamycin/Doxorubicin - intercalates DNA