UniProt UniProt http://www.uniprot.org Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. In Supplementary Figure 3A/B (HMGB1 is colocalized with LC3B, an autophagy marker molecule, and also with some 97Q-GFP aggregates ); HTT is detected by tag fluorescence and the other two molecules by PLA. jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy immunostaining immunostaining Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. Mouse embryonic primary striatal neuronal cells jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. Mouse embryonic primary striatal neuronal cells jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy immunostaining immunostaining Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunostaining immunostaining Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. MEF hmgb1-/- cells jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. Mouse embryonic primary striatal neuronal cells jsshin6203@yuhs.ac Accepted 2015-AUG-17 by MGT Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation hmgb1_human High mobility group protein B1 HMGB1 HMG1 High mobility group protein 1 protein protein human Homo sapiens Human MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE DIP protein P09429 original sequence version: 141 8A868CF277D417B5 hd_human Huntingtin HTT IT15 HD Huntington disease protein protein protein human Homo sapiens Human MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHSTLLILGVLLTLRYLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQTLTAVGGIGQLTAAKEESGGRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCGTLICSILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLCSSSYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFPVCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKVSTQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDYRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEELDRRAFQSVLEVVAAPGSPYHRLLTCLRNVHKVTTC DIP protein P42858 original sequence version: 148 DIP protein P42858 original sequence version: 145 DIP protein P42858 original sequence version: 142 DIP protein P42858 original sequence version: 157 DIP protein P42858 original sequence version: 158 DIP protein P42858 original sequence version: 156 A267509E84D52F0D mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV DIP protein Q9GZQ8 original sequence version: 69 DIP protein Q9GZQ8 original sequence version: 108 DIP protein Q9GZQ8 original sequence version: 129 DIP protein Q9GZQ8 original sequence version: 132 DIP protein Q9GZQ8 original sequence version: 148 DIP protein Q9GZQ8 original sequence version: 152 DIP protein Q9GZQ8 original sequence version: 111 DIP protein Q9GZQ8 original sequence version: 153 BB141DEC7653E83F hmgb1-htt-1 8 12 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed May 02 16:31:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 15:56:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 3A, supplemental 1A and 2C trichostatin A htt-hmgb1-5 4 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ disease polyQ extension Wed May 02 17:40:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 16:35:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' P42858:p.Gln18[25] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQ normal polyQ extension Wed May 02 18:43:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q25 poly-glutamine extension' Tue Jun 30 19:21:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[25]' 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined hmg_box_domain 1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain hmg_box_domain 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3B and D htt-hmgb1-1 1 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ disease polyQ extension Wed May 02 18:12:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 19:35:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined hmg_box_domain 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain hmg_box_domain 1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3B and D hmgb1-htt-3 6 12 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed May 02 14:37:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 16:44:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3C hmgb1-htt-4 2 12 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed May 02 18:43:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 16:45:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role neutral component neutral component purified purified region rhodamine label rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. colocalization colocalization 6c hmgb1-htt-5 8 12 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed May 02 19:14:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 19:47:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. colocalization colocalization 6b hmgb1-htt-7 9 12 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed May 02 20:25:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 18:51:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 7A hmgb1-htt-6 3 12 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed May 02 19:14:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 19:50:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 9D htt-hmgb1-2 4 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ disease polyQ extension Wed May 02 17:14:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 17:27:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association 6A htt-hmgb1-3 5 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ disease polyQ extension Wed May 02 15:42:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 20:11:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 9E hmgb1-htt-2 6 13 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction supplemental 3A hmgb1-htt-8 10 12 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed May 02 15:14:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 19:08:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role neutral component neutral component purified purified region rhodamine label rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. colocalization colocalization 9I hmgb1-htt-9 7 12 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed May 02 19:06:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 19:13:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region rhodamine label rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. colocalization colocalization 7E hmgb1-htt-10 2 13 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain QQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed May 02 17:04:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'q97 poly-glutamine extension' Tue Jun 30 17:40:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln18[97]' 11 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Supp 3A