IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Biochem. Biophys. Res. Commun. (0006-291X) 2012 imex curation Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-bd3 Mouse BD3 ES cell line- deficient in PS2 bd3 BD3 ES cell line- deficient in PS2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Biochem. Biophys. Res. Commun. (0006-291X) 2012 imex curation Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] pull down pull down western blot western blot Immuno blot Immuno blot Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Biochem. Biophys. Res. Commun. (0006-291X) 2012 imex curation Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Biochem. Biophys. Res. Commun. (0006-291X) 2012 imex curation Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-bd8 Mouse BD8 cell line - Blastocyst derived ES cells lacking PS1 +2 bd8 Mouse BD8 cell line - Blastocyst derived ES cells lacking PS1 +2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Biochem. Biophys. Res. Commun. (0006-291X) 2012 imex curation Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-brain-cortex Homo sapiens brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] pull down pull down western blot western blot Immuno blot Immuno blot Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. Biochem. Biophys. Res. Commun. (0006-291X) 2012 imex curation Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Can you figure out if they used Rat or Human Brain in fig IA?? - I could not. Ref 10 uses both types of brain, again. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation p97887-pro_0000025600 Presenilin-1 CTF subunit Psen1 Psnl1 Protein S182 protein protein rat Rattus norvegicus (Rat) Rat AEGDPEAQRRVPKNPKYSTQGTEREETQDTGTGSDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSGSILTSEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLIFYFATDYLVQPFMDQLAFHQFYI 299 468 C19336F98328F63A gcb GCB small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) psn1_mouse Presenilin-1 Protein S182 Psen1 Ad3h Psnl1 protein protein mouse Mus musculus Mouse MTEIPAPLSYFQNAQMSEDSHSSSAIRSQNDSQERQQQHDRQRLDNPEPISNGRPQSNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVIMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYVTVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVPKNPKYNTQRAERETQDSGSGNDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSGSILTSEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI DIP protein P49769 original sequence version: 150 DIP protein P49769 original sequence version: 110 D07215B4BAD2D549 erln2_rat Erlin-2 Erlin2 Spfh2 Endoplasmic reticulum lipid raft-associated protein 2 Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2 protein protein rat Rattus norvegicus (Rat) Rat MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTALKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGGLGKQSEGLSDKLGFGLEDEPLETATKDN A777F11C4B1A47D7 p97887-pro_0000025599 Presenilin-1 NTF subunit Psen1 Psnl1 Protein S182 protein protein rat Rattus norvegicus (Rat) Rat MTEIPAPLSYFQNAQMSEDSHSSSVRSQNDNQERQQHHDRQRLDNPESISNGRPQSNFTRQVIEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIVSSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNM 1 298 5DD6EE5705C9DC6E nica_human Nicastrin NCSTN KIAA0253 UNQ1874/PRO4317 protein protein human Homo sapiens Human MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTFSINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY DIP protein Q92542 original sequence version: 74 DIP protein Q92542 original sequence version: 146 C8C0EAEAD89E976A nica_rat Nicastrin Ncstn protein protein rat Rattus norvegicus (Rat) Rat MATARGGSGPDPGSRGLLLLSFSVVLAGLCGGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEDDLKWVLTDGPNPPYMVLLEGKLFTRDIMEKLKGETSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLWNELGNGLAYDDFSFPIFLLEDENETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCMRRSFIQSTFSINPEIVCDPLSDYNVWSMLKPINTSGGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMENGKFPVRLENIDSFVELGQVALRTSLELWMHTDPMSQKNESVKNQVEDLLVTLEQSGADTPQVVLSRLVQSQALPPSSLQRFLRARNISGVVLADHSGSFHNRYYQSIYDTAENINVTYPESQSPEEDLNFVTDTAKALADVATVLARALYKLAGGTNFNNSIQADPQTVTRLLYGFLVRANNSWFQSILRHDLRSYLDDGPLQHYIAVSSPTNTTYVVQYALANLTGKVTNLTQEQCQDPSKVPNESKDLYEYSWVQGPWNSNKTERLPRCVRSTVRLARALSPAFELSQWSSTEYSTWAESRWKDIQARIFLIASKELEFITLIVGFSILVFSLIVTYCINAKADVLFVAPREPGAVSY 023713E3526F393F erln2_human Erlin-2 ERLIN2 C8orf2 SPFH2 Endoplasmic reticulum lipid raft-associated protein 2 Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2 UNQ2441/PRO5003/PRO9924 protein protein human Homo sapiens Human MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN 3CF322548FD58DB0 p49768-pro_0000025591 Presenilin-1 NTF subunit PSEN1 AD3 PS1 PSNL1 Protein S182 protein protein human Homo sapiens Human MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNM 1 298 58C420367AAEC20B erln2_mouse Erlin-2 Erlin2 Spfh2 Endoplasmic reticulum lipid raft-associated protein 2 Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2 protein protein mouse Mus musculus Mouse MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTALKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGGLGKQFEGLSDDKLGFGLEDEPLEAPTKEN DA76718E5DCB7664 gcb-erlin2-4 5 15 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1B L-685,458 -a gamma secretase inhibitor The N-terminal domain of Presenilin-1 is identified by a combination of molecular weight and western blot. gcb-erlin2-5 2 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1B/C L-685,458 -a gamma secretase inhibitor The N-terminal domain of Presenilin-1 was identified by a combination of molecular weight and western blot. erlin2-gcb 6 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association 1D/E There was a higher degree of interaction between erlin-2 and gamma-secretase in DRMs. erlin2-psen1 4 16 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2A weak interaction - BD8 cells are deficient in PS1 and 2. erlin2-psen1-1 1 16 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2C erlin2-gcb-1 3 16 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2 E-G