IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Mol. Cell Proteomics (1535-9476) 2012 imex curation Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Accepted 2013-AUG-08 by ORCHARD 09-Aug-2013: Contacted by IntAct-Help. Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Mol. Cell Proteomics (1535-9476) 2012 imex curation Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Accepted 2013-AUG-08 by ORCHARD 09-Aug-2013: Contacted by IntAct-Help. Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Mol. Cell Proteomics (1535-9476) 2012 imex curation Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Normal mucosal epithelial cells of colon tissue obtained from healthy individuals. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Accepted 2013-AUG-08 by ORCHARD 09-Aug-2013: Contacted by IntAct-Help. Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Mol. Cell Proteomics (1535-9476) 2012 imex curation Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. According to OLS I should not annotate to the GO term "Interphase" or children of. No idea as to why, and all those who might know are on holiday...Apparently Jane Lomax knows or Beccy (?) So I have added "Interphase" in a Comment. (However I have added "mitosis" as an XRef - no problem with this term - bizarre...) Triple PLAs are shown in in Soderberg et al. 2006, Ref 10 - PMID:17072308. See figure 2f/g. The authors confirm that you would not expect a positive PLA signal if only two of the targeted proteins were present. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Accepted 2013-AUG-08 by ORCHARD 09-Aug-2013: Contacted by IntAct-Help. Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Mol. Cell Proteomics (1535-9476) 2012 imex curation Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Mucosal epithelial cells from colon tissue obtained from individuals with colorectal cancer (adenoma), and invasive adenocarcinoma. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Accepted 2013-AUG-08 by ORCHARD 09-Aug-2013: Contacted by IntAct-Help. Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. Mol. Cell Proteomics (1535-9476) 2012 imex curation Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-nmumg Mus musculus NMuMG mammary gland epithelial cells nmumg NMuMG mammary gland epithelial cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Accepted 2013-AUG-08 by ORCHARD 09-Aug-2013: Contacted by IntAct-Help. Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation smad2_mouse Mothers against decapentaplegic homolog 2 Smad2 Madh2 Madr2 Mad-related protein 2 SMAD family member 2 protein protein mouse Mus musculus Mouse MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 31A2A36D463DB3E9 smad4_mouse Mothers against decapentaplegic homolog 4 Smad4 Dpc4 Madh4 Deletion target in pancreatic carcinoma 4 homolog SMAD family member 4 protein protein mouse Mus musculus Mouse MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSMLVKDEYVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQIASGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD DIP protein P97471 original sequence version: 79 DIP protein P97471 original sequence version: 150 4FBDF5DED4442F86 smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS DIP protein Q8BUN5 original sequence version: 57 46DF5E8B371321AC ski_human Ski oncogene SKI Proto-oncogene c-Ski protein protein human Homo sapiens Human MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAVPAPVPAATEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGLEAELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAENEKKMKEANESRLRLKRELEQARQARVCDKGCEAGRLRAKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEKVVKELQEQLWPRARPEAAGSEGAAELEP DIP protein P12755 original sequence version: 126 DIP protein P12755 original sequence version: 130 9B78C4840A28C2DA smad3_human Mothers against decapentaplegic homolog 3 SMAD3 MADH3 SMAD family member 3 JV15-2 protein protein human Homo sapiens Human MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS DIP protein P84022 original sequence version: 57 DIP protein P84022 original sequence version: 112 DIP protein P84022-1 original sequence version: 146 DIP protein P84022-1 original sequence version: 111 46DF5E8B371321AC p12757-1 Ski-like protein Ski-related protein Ski-related oncogene SNO SKIL protein protein human Homo sapiens Human MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQKTVSYPDVSLEEQEKMDLKTSRELCSRLDASISNNSTSKRKSESATCNLVRDINKVGIGLVAAASSPLLVKDVICEDDKGKIMEEVMRTYLKQQEKLNLILQKKQQLQMEVKMLSSSKSMKELTEEQQNLQKELESLQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLAELRQRLDHAEADRQELQDELRQEREARQKLEMMIKELKLQILKSSKTAKE 6A04D4ECEC214CF1 smad2_human Mothers against decapentaplegic homolog 2 SMAD2 MADH2 MADR2 Mad-related protein 2 SMAD family member 2 JV18-1 protein protein human Homo sapiens Human MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS DIP protein Q15796 original sequence version: 174 DIP protein Q15796 original sequence version: 100 DIP protein Q15796-1 original sequence version: 141 95406DB5FC0AA4C9 smad4_human Mothers against decapentaplegic homolog 4 SMAD4 DPC4 MADH4 SMAD family member 4 Deletion target in pancreatic carcinoma 4 protein protein human Homo sapiens Human MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD DIP protein Q13485 original sequence version: 149 DIP protein Q13485 original sequence version: 177 7EE3C4647712DA90 smad2-smad4-9 1 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1A TGF-beta smad2-smad4-10 1 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1A TGF-beta smad2-smad3-1 1 8 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1B TGF-beta There are several e.g.s of triple PLAs in the literature....though this paper does not seem to refer to any of them (as far as I can see). I assume this is a "kosher" reaction? smad3-smad4-3 4 11 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1D, 2A, 2C, 2D, 2E, 3, Supp2A, 4B, Supp4 TGF-beta;the dose-dependent assembly of Smad3-Smad4 complexes reached a maximum at a concentration of 20 ng/ml TGF-beta. MG132 - proteasome inhibitor There was significant accumulation of Smad2-Smad4 and Smad3-Smad4 complexes in nuclei of stimulated cells 20 min after the addition of TGF-beta; this was sustained up to 45 min after the addition of TGF-beta, when the number of complexes attained a maximal value before decreasing again. Signals found in Interphase smad3-smad4-4 4 14 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1C, 2A, 2B, 4A, Supp 4, Supp1. TGF-beta;The highest accumulation of complexes between Smad2 and Smad4 was observed at a concentration of 20 ng/ml. There was significant accumulation of Smad2-Smad4 and Smad3-Smad4 complexes in nuclei of stimulated cells 20 min after the addition of TGF-beta; this was sustained up to 45 min after the addition of TGF-beta, when the number of complexes attained a maximal value before decreasing again. Signals found in Interphase skil-smad2 4 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction Supp 3(D), 4D, Supp 4 Elevated numbers of these complexes were seen in mitotic cells and a lower level of complexes in cells in interphase. skil-smad2-1 4 13 unspecified role unspecified role neutral component neutral component possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 3C, Supp 2C, 4C, Supp 4 MG132 -proteasome inhibitor Elevated numbers of these complexes were seen in mitotic cells and a lower level of complexes in cells in interphase. smad2-smad4-11 3 13 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5A smad2-smad4-12 3 14 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5B smad2-smad4-13 5 13 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5C/E smad2-smad4-13 5 14 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5D/F smad2-smad4-14 2 13 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Supp 1 smad2-smad4-15 6 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Supp 1 TGF-beta