IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural and functional protein network analyses predict novel signaling functions for rhodopsin. Structural and functional protein network analyses predict novel signaling functions for rhodopsin. Mol. Syst. Biol. 2011 imex curation Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Affinomics - Interactions curated for the Affinomics consortium. email sent 10/2 - no reply anticipated...none received:- Regarding Supplementary Figure 5 . There appears to be several more proteins identified in Supp figure 5 than are given for "sedimentation" in Supp Table 6: - no other place these results are listed (that I can find - Supp table 1 is just "raw" lysate). Also "Supplementary Figure 5" is NOT mentioned in the main body of the paper, for some reason. cesareni@uniroma2.it,luis.serrano@crg.eu,marius.ueffing@uni-tuebingen.de 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions pig-retina-rod_outer_segment Pig Rod Outer Segment retina-rod_outer_segment rod outer segment bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Affinomics - Interactions curated for the Affinomics consortium. email sent 10/2 - no reply anticipated...none received:- Regarding Supplementary Figure 5 . There appears to be several more proteins identified in Supp figure 5 than are given for "sedimentation" in Supp Table 6: - no other place these results are listed (that I can find - Supp table 1 is just "raw" lysate). Also "Supplementary Figure 5" is NOT mentioned in the main body of the paper, for some reason. Two dimensional electrophoresis: BN page followed by SDS-PAGE. cesareni@uniroma2.it,luis.serrano@crg.eu,marius.ueffing@uni-tuebingen.de Accepted 2014-APR-01 by ORCHARD Mol. Syst. Biol. 2011 Only protein-protein interactions imex curation Structural and functional protein network analyses predict novel signaling functions for rhodopsin. Structural and functional protein network analyses predict novel signaling functions for rhodopsin. Mol. Syst. Biol. 2011 imex curation Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Affinomics - Interactions curated for the Affinomics consortium. email sent 10/2 - no reply anticipated...none received:- Regarding Supplementary Figure 5 . There appears to be several more proteins identified in Supp figure 5 than are given for "sedimentation" in Supp Table 6: - no other place these results are listed (that I can find - Supp table 1 is just "raw" lysate). Also "Supplementary Figure 5" is NOT mentioned in the main body of the paper, for some reason. cesareni@uniroma2.it,luis.serrano@crg.eu,marius.ueffing@uni-tuebingen.de 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions pig-retina-rod_outer_segment Pig Rod Outer Segment retina-rod_outer_segment rod outer segment density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Affinomics - Interactions curated for the Affinomics consortium. email sent 10/2 - no reply anticipated...none received:- Regarding Supplementary Figure 5 . There appears to be several more proteins identified in Supp figure 5 than are given for "sedimentation" in Supp Table 6: - no other place these results are listed (that I can find - Supp table 1 is just "raw" lysate). Also "Supplementary Figure 5" is NOT mentioned in the main body of the paper, for some reason. Rho ABC was found in this complex, but cannot be identified due to lack of antibody specificity. "Arrestin" was found in this complex, but also cannot be identified. cesareni@uniroma2.it,luis.serrano@crg.eu,marius.ueffing@uni-tuebingen.de Accepted 2014-APR-01 by ORCHARD Mol. Syst. Biol. 2011 Only protein-protein interactions imex curation Structural and functional protein network analyses predict novel signaling functions for rhodopsin. Structural and functional protein network analyses predict novel signaling functions for rhodopsin. Mol. Syst. Biol. 2011 imex curation Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Affinomics - Interactions curated for the Affinomics consortium. email sent 10/2 - no reply anticipated...none received:- Regarding Supplementary Figure 5 . There appears to be several more proteins identified in Supp figure 5 than are given for "sedimentation" in Supp Table 6: - no other place these results are listed (that I can find - Supp table 1 is just "raw" lysate). Also "Supplementary Figure 5" is NOT mentioned in the main body of the paper, for some reason. cesareni@uniroma2.it,luis.serrano@crg.eu,marius.ueffing@uni-tuebingen.de 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions pig-retina-rod_outer_segment Pig Rod Outer Segment retina-rod_outer_segment rod outer segment anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Affinomics - Interactions curated for the Affinomics consortium. no email sent 10/2 - no reply anticipated...none received:- Regarding Supplementary Figure 5 . There appears to be several more proteins identified in Supp figure 5 than are given for "sedimentation" in Supp Table 6: - no other place these results are listed (that I can find - Supp table 1 is just "raw" lysate). Also "Supplementary Figure 5" is NOT mentioned in the main body of the paper, for some reason. Rho ABC was found in this complex, but cannot be identified due to lack of antibody specificity. cesareni@uniroma2.it,luis.serrano@crg.eu,marius.ueffing@uni-tuebingen.de Accepted 2014-APR-01 by ORCHARD Mol. Syst. Biol. 2011 Only protein-protein interactions imex curation Structural and functional protein network analyses predict novel signaling functions for rhodopsin. Structural and functional protein network analyses predict novel signaling functions for rhodopsin. Mol. Syst. Biol. 2011 imex curation Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Affinomics - Interactions curated for the Affinomics consortium. email sent 10/2 - no reply anticipated...none received:- Regarding Supplementary Figure 5 . There appears to be several more proteins identified in Supp figure 5 than are given for "sedimentation" in Supp Table 6: - no other place these results are listed (that I can find - Supp table 1 is just "raw" lysate). Also "Supplementary Figure 5" is NOT mentioned in the main body of the paper, for some reason. cesareni@uniroma2.it,luis.serrano@crg.eu,marius.ueffing@uni-tuebingen.de 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Affinomics - Interactions curated for the Affinomics consortium. email sent 10/2 - no reply anticipated...none received:- Regarding Supplementary Figure 5 . There appears to be several more proteins identified in Supp figure 5 than are given for "sedimentation" in Supp Table 6: - no other place these results are listed (that I can find - Supp table 1 is just "raw" lysate). Also "Supplementary Figure 5" is NOT mentioned in the main body of the paper, for some reason. Rho ABC was found in this complex, but cannot be identified due to lack of antibody specificity. cesareni@uniroma2.it,luis.serrano@crg.eu,marius.ueffing@uni-tuebingen.de Accepted 2014-APR-01 by ORCHARD Mol. Syst. Biol. 2011 Only protein-protein interactions imex curation cona_canen Concanavalin-A protein protein canen Canavalia ensiformis (Jack bean) Horse bean MAISKKSSLFLPIFTFITMFLMVVNKVSSSTHETNALHFMFNQFSKDQKDLILQGDATTGTDGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFEATFTFLIKSPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDANVIRNSTTIDFNAAYNADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSNEIPDIATVV 0F2F7DBBCF547E42 opsd_pig Rhodopsin RHO RHO1 protein protein pig Sus scrofa (Pig) Pig MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQFSMLAAYMFMLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGLALTWVMALACAAPPLVGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFSIPLVIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVVAFLICWLPYASVAFYIFTHQGSDFGPIFMTIPAFFAKSASIYNPVIYIMMNKQFRNCMLTTLCCGKNPLGDDEASTTTSKTETSQVAPA 272E6B0BEE3DA51B rock2_pig Rho-associated protein kinase 2 ROCK2 Rho kinase 2 Rho-associated, coiled-coil-containing protein kinase 2 Rho-associated, coiled-coil-containing protein kinase II p164 ROCK-2 protein protein pig Sus scrofa (Pig) Pig MSRPPPTGKMPGAPEAVSGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWNWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSPSCKENDSIQIRKNEESQEIQKKLYTLEEHLSTEIQAKEELEQKCKSVNTRLEKVAKELEEEIALRKNVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKDFINLQSVLESERRDRTHGSEIINDLQGRISGLEEDLKNGKILLTKVEMEKRQLQERFTDLEKEKNNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSILDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMSLEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLCKELQQKKQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDTTIASLEETNRTLTSDVANLANEKEELNNKLKDAQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDMRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPGDAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNCICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISSAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAANKPS CD7DEAC913D7AE04 i3lfi0_pig RAC1 protein protein pig Sus scrofa (Pig) Pig AVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTQDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL The sequence has been withdrawn from uniprot. F8BD16094E380A79 f1smv2_pig Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta PDE6D protein protein pig Sus scrofa (Pig) Pig MPYSSLICLIRNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV D8282AD182CC2398 i3lje2_pig Dihydropyrimidinase-related protein 2 DPYSL2 protein protein pig Sus scrofa (Pig) Pig MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLSAFDQWREWADSKSCCDYSLHVDITEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDSQIYEVLSVIRDIGAIAQVHAENGDIIAEVEAEAVNRSITIANQTNCPLYITKVMSKSAAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSIIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG D3925D5AD630AE1B i3la61_pig GNAT1 protein protein pig Sus scrofa (Pig) Pig GAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFERASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSICFPDYNGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF 6E9D0FD6D44F7D43 pde6d-rac1 1 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 7A dpysl2-gnat1 2 8 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp 6A cona-dpysl2-2 4 10 unspecified role unspecified role prey prey pig-retina-rod_outer_segment Pig Rod Outer Segment retina-rod_outer_segment rod outer segment 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey pig-retina-rod_outer_segment Pig Rod Outer Segment retina-rod_outer_segment rod outer segment 11 unspecified role unspecified role prey prey pig-retina-rod_outer_segment Pig Rod Outer Segment retina-rod_outer_segment rod outer segment association association Supp 6C AMM:-methylmannoside -lowers the affinity of proteins for the beads. cona-dpysl2-3 3 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp 6D