IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Hum. Mol. Genet. (0964-6906) 2012 imex curation Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2012 Only protein-protein interactions imex curation Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Hum. Mol. Genet. (0964-6906) 2012 imex curation Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2012 Only protein-protein interactions imex curation Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Hum. Mol. Genet. (0964-6906) 2012 imex curation Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2012 Only protein-protein interactions imex curation Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Hum. Mol. Genet. (0964-6906) 2012 imex curation Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-nasal_mucosa Homo sapiens nasal_mucosa Nasal Mucosa confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2012 Only protein-protein interactions imex curation Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Hum. Mol. Genet. (0964-6906) 2012 imex curation Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2012 Only protein-protein interactions imex curation Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Disruption of cytokeratin-8 interaction with F508del-CFTR corrects its functional defect. Hum. Mol. Genet. (0964-6906) 2012 imex curation Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Colas J., Faure G., Saussereau E., Trudel S., Rabeh W.M., Bitam S., Guerrera I.C., Fritsch J., Sermet-Gaudelus I., Davezac N., Brouillard F., Lukacs G.L., Herrmann H., Ollero M., Edelman A. Affinomics - Interactions curated for the Affinomics consortium. (Amino acid numbering for the NBD1 domain was taken from Ref. 21- Wang. C.) the supplementary file does not open. there is an incorrect file extension used - save, + rename by removing the "x" from .docx and it will then open. Epithelial cells were isolated from human nasal polyps, trachea or bronchus. Then, they were amplified and seeded at a high density onto microporous filters, and maintained at the air-liquid interface. SPR results (figure 2 and Supplementary figure 1, Table S2) have not been included as the origins/species of K8 are not given in the publication and the authors did not respond to a request for information. mario.ollero@inserm.fr Accepted 2013-AUG-27 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2012 Only protein-protein interactions imex curation hsp71_human Heat shock 70 kDa protein 1A/1B HSPA1A HSPA1 HSPA1B Heat shock 70 kDa protein 1/2 HSX70 protein protein human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD 78F513118C96DE66 cftr_human Cystic fibrosis transmembrane conductance regulator CFTR ABCC7 cAMP-dependent chloride channel ATP-binding cassette sub-family C member 7 Channel conductance-controlling ATPase protein protein human Homo sapiens Human MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL 8D082AA2E768C065 k1c18_human Keratin, type I cytoskeletal 18 KRT18 CYK18 Keratin-18 PIG46 Cytokeratin-18 Cell proliferation-inducing gene 46 protein protein protein human Homo sapiens Human MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH DIP protein P05783 original sequence version: 186 DIP protein P05783 original sequence version: 175 1E5604C6BCC7A17A k1c17_human Keratin, type I cytoskeletal 17 KRT17 Cytokeratin-17 39.1 Keratin-17 protein protein human Homo sapiens Human MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEELQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR DIP protein Q04695 original sequence version: 143 35B429243F47EB5C cftr_mouse Cystic fibrosis transmembrane conductance regulator Cftr Abcc7 ATP-binding cassette sub-family C member 7 Channel conductance-controlling ATPase cAMP-dependent chloride channel protein protein mouse Mus musculus Mouse MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSADSADHLSEKLEREWDREQASKKNPQLIHALRRCFFWRFLFYGILLYLGEVTKAVQPVLLGRIIASYDPENKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHRIGMQMRTAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFIWIAPLQVTLLMGLLWDLLQFSAFCGLGLLIILVIFQAILGKMMVKYRDQRAAKINERLVITSEIIDNIYSVKAYCWESAMEKMIENLREVELKMTRKAAYMRFFTSSAFFFSGFFVVFLSVLPYTVINGIVLRKIFTTISFCIVLRMSVTRQFPTAVQIWYDSFGMIRKIQDFLQKQEYKVLEYNLMTTGIIMENVTAFWEEGFGELLEKVQQSNGDRKHSSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFSVDDSSAPWSKPKQSFRQTGEVGEKRKNSILNSFSSVRKISIVQKTPLCIDGESDDLQEKRLSLVPDSEQGEAALPRSNMIATGPTFPGRRRQSVLDLMTFTPNSGSSNLQRTRTSIRKISLVPQISLNEVDVYSRRLSQDSTLNITEEINEEDLKECFLDDVIKIPPVTTWNTYLRYFTLHKGLLLVLIWCVLVFLVEVAASLFVLWLLKNNPVNSGNNGTKISNSSYVVIITSTSFYYIFYIYVGVADTLLALSLFRGLPLVHTLITASKILHRKMLHSILHAPMSTISKLKAGGILNRFSKDIAILDDFLPLTIFDFIQLVFIVIGAIIVVSALQPYIFLATVPGLVVFILLRAYFLHTAQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFRRQTYFETLFHKALNLHTANWFMYLATLRWFQMRIDMIFVLFFIVVTFISILTTGEGEGTAGIILTLAMNIMSTLQWAVNSSIDTDSLMRSVSRVFKFIDIQTEESMYTQIIKELPREGSSDVLVIKNEHVKKSDIWPSGGEMVVKDLTVKYMDDGNAVLENISFSISPGQRVGLLGRTGSGKSTLLSAFLRMLNIKGDIEIDGVSWNSVTLQEWRKAFGVITQKVFIFSGTFRQNLDPNGKWKDEEIWKVADEVGLKSVIEQFPGQLNFTLVDGGYVLSHGHKQLMCLARSVLSKAKIILLDEPSAHLDPITYQVIRRVLKQAFAGCTVILCEHRIEAMLDCQRFLVIEESNVWQYDSLQALLSEKSIFQQAISSSEKMRFFQGRHSSKHKPRTQITALKEETEEEVQETRL 3D1B0BBDD80C1DA8 k1c10_human Keratin, type I cytoskeletal 10 KRT10 Cytokeratin-10 KPP Keratin-10 protein protein human Homo sapiens Human MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRGSSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGIFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY 4941ECD2AE46D417 bip_human Endoplasmic reticulum chaperone BiP HSPA5 GRP78 Immunoglobulin heavy chain-binding protein 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein human Homo sapiens Human MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL DIP protein P11021 original sequence version: 127 DIP protein P11021 original sequence version: 137 DIP protein P11021 original sequence version: 185 59B7D8D85BC32A00 k1c9_human Keratin, type I cytoskeletal 9 KRT9 Keratin-9 Cytokeratin-9 protein protein human Homo sapiens Human MSCRQFSSSYLSRSGGGGGGGLGSGGSIRSSYSRFSSSGGGGGGGRFSSSSGYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGFGGFGGGAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEANNDLENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFRIKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEIECQNQEYSLLLSIKMRLEKEIETYHNLLEGGQEDFESSGAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGKSSHS 45C833749B63873D caspe_human Caspase-14 CASP14 protein protein human Homo sapiens Human MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQAIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ E539FB7E8DD808A2 k2c8_human Keratin, type II cytoskeletal 8 Keratin-8 KRT8 CYK8 Cytokeratin-8 Type-II keratin Kb8 protein protein human Homo sapiens Human MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDVLPK DIP protein P05787 original sequence version: 186 DIP protein P05787 original sequence version: 146 B0BC730B65929D37 actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 k2c8_mouse Keratin, type II cytoskeletal 8 Krt8 Krt2-8 Cytokeratin endo A Cytokeratin-8 Keratin-8 Type-II keratin Kb8 protein protein mouse Mus musculus Mouse MSIRVTQKSYKMSTSGPRAFSSRSFTSGPGARISSSSFSRVGSSSSSFRGSMGTGVGLGGFGGAGVGGITAVTVNQSLLSPLKLEVDPNIQAVRTQEKEQIKSLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTSRSNMDNMFESYINNLRRQLEALGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQIHEEEIRELQSQISDTSVVLSMDNSRSLDMDGIIAEVRAQYEDIANRSRAEAETMYQIKYEELQTLAGKHGDDLRRTKTEISEMNRNINRLQAEIEALKGQRASLEAAIADAEQRGEMAIKDAQTKLAELEAALQRAKQDMARQLREYQELMNVKLALDIEITTYRKLLEGEESRLESGMQNMSIHTKTTSGYSGGLSSSYGGLTSPGFSYGMSSFQPGFGSAGGSNTFSRTTKAVVVKKIETRDGKLVSESSDVVSK C0C79590F0C28502 tcpa_human T-complex protein 1 subunit alpha CCTA TCP1 CCT1 CCT-alpha protein protein human Homo sapiens Human MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHSGALND DIP protein P17987 original sequence version: 114 DIP protein P17987 original sequence version: 123 486ECA836EA258A1 vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE DIP protein P08670 original sequence version: 195 DIP protein P08670 original sequence version: 209 DIP protein P08670 original sequence version: 192 DIP protein P08670 original sequence version: 175 BAB54026665B015A dsg1_human Desmoglein-1 CDHF4 Desmosomal glycoprotein 1 Pemphigus foliaceus antigen DSG1 Cadherin family member 4 protein protein human Homo sapiens Human MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACREGEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQENTLNSNLLEIRVIDLDEEFSANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIGVRNKAEFHHSIMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLLSDNVHFGPAGIGLLIMGFLVLGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVEGPQPEPRDITTVIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGERMTGFELTEGVKTSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKESYPDLDPSWPPQSTEPVCLPQETEPVVSGHPPISPHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTESYTTSDTLKPSVHVHDNRPASNVVVTERVVGPISGADLHGMLEMPDLRDGSNVIVTERVIAPSSSLPTSLTIHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAGVTGISGTTGISGGIGSSGLVGTSMGAGSGALSGAGISGGGIGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYSK FEA471244B9D67AE xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD DIP protein P12956 original sequence version: 184 DIP protein P12956 original sequence version: 138 DIP protein P12956 original sequence version: 185 DIP protein P12956 original sequence version: 164 DIP protein P12956 original sequence version: 166 BBD3CD434526DFCB myh9_human Myosin-9 MYH9 Myosin heavy chain 9 Myosin heavy chain, non-muscle IIa Non-muscle myosin heavy chain IIa Cellular myosin heavy chain, type A Non-muscle myosin heavy chain A protein protein human Homo sapiens Human MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE DIP protein P35579 original sequence version: 126 DIP protein P35579-1 original sequence version: 142 DIP protein P35579-1 original sequence version: 133 DIP protein P35579 original sequence version: 186 DIP protein P35579-1 original sequence version: 186 DIP protein P35579-1 original sequence version: 146 DIP protein P35579 original sequence version: 146 588F84BB8C106E6F cftr-actb 6 20 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association 1A and Supplementary Table S1 cftr-actb-10 6 19 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait P13569:p.Phe508del mutation mutation deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain F . Wed May 02 20:23:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 16:49:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' 12 unspecified role unspecified role prey prey association association 1A and Supplementary Table S1_mutant cftr-krt8-1 3 16 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 1B cftr-krt8-2 3 8 unspecified role unspecified role neutral component neutral component P13569:p.Phe508del mutation mutation deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain F . Wed May 02 19:29:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 16:00:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' 16 unspecified role unspecified role neutral component neutral component colocalization colocalization 1B, 4B cftr-krt8-3 4 8 unspecified role unspecified role neutral component neutral component P13569:p.Phe508del mutation mutation deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain F . Wed May 02 18:19:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 17:01:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' 16 unspecified role unspecified role neutral component neutral component colocalization colocalization 1C There was no apparent colocalization of CFTR, confined to the base of cilia, in nasal cells from healthy individuals (Fig. 1C, upper panel). cftr-krt8-7 5 8 unspecified role unspecified role neutral component neutral component P13569:p.Phe508del mutation mutation deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain F . Wed May 02 18:32:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 15:38:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' 16 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3A, 4C A <40 nm proximity between both proteins was found in F508del-CFTR, but not in WT-CFTR-expressing cells (Fig. 3A). cftr-krt8-8 1 16 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component P13569:p.Phe508del mutation mutation deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain F . Wed May 02 15:35:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 19:01:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' proximity proximity close-contact colocalization neighbourhood interaction 3B Molecular proximity of K8 and CFTR was detectable in CF patients cells (homozygous for F508del mutation) only. cftr-krt8-9 2 8 unspecified role unspecified role bait bait nbd1_domain sufficient to bind sufficient binding region sufficient to bind range range range range P13569:p.Phe508del mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain F . Wed May 02 16:50:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 16:45:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' 16 unspecified role unspecified role prey prey direct interaction direct interaction 2A, Supp Table 2 Kds for WT and Mutant were similar at +7 degrees C (Figure 2B):- 70nM and 80 nM respectively. At 20/25 degrees C (Supplementary Table 2) values were 29 nM (mutant) and 80 nM (WT). cftr-krt8-10 2 18 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait nbd1_domain sufficient to bind sufficient binding region sufficient to bind range range range range P26361:p.Phe508del mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain F . Wed May 02 18:30:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 17:49:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' direct interaction direct interaction Supp figure 1, Supp Table 2 At 20/25 degrees C Kd values were 16 nM (mutant) and 48 nM (WT).