IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Tumor-associated calcium signal transducer 2 is required for the proper subcellular localization of claudin 1 and 7: implications in the pathogenesis of gelatinous drop-like corneal dystrophy. Tumor-associated calcium signal transducer 2 is required for the proper subcellular localization of claudin 1 and 7: implications in the pathogenesis of gelatinous drop-like corneal dystrophy. Am. J. Pathol. (0002-9440) 2010 imex curation Nakatsukasa M., Kawasaki S., Yamasaki K., Fukuoka H., Matsuda A., Tsujikawa M., Tanioka H., Nagata-Takaoka M., Hamuro J., Kinoshita S. Affinomics - Interactions curated for the Affinomics consortium. Cannot see Supplement - although I can get FREE access to the main body of this paper via PubMed, there is no link to the Supplement here; we do not appear to have a subscription to this journal. However I do not think there is anything to annotate from reading text, as all results appear to be negative.... bluenova@koto.kpu-m.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-cornea Human cornea cornea CORNEA pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Nakatsukasa M., Kawasaki S., Yamasaki K., Fukuoka H., Matsuda A., Tsujikawa M., Tanioka H., Nagata-Takaoka M., Hamuro J., Kinoshita S. Affinomics - Interactions curated for the Affinomics consortium. Cannot see Supplement - although I can get FREE access to the main body of this paper via PubMed, there is no link to the Supplement here; we do not appear to have a subscription to this journal. However I do not think there is anything to annotate from reading text, as all results appear to be negative.... bluenova@koto.kpu-m.ac.jp Accepted 2014-APR-11 by ORCHARD Am. J. Pathol. (0002-9440) 2010 Only protein-protein interactions imex curation Tumor-associated calcium signal transducer 2 is required for the proper subcellular localization of claudin 1 and 7: implications in the pathogenesis of gelatinous drop-like corneal dystrophy. Tumor-associated calcium signal transducer 2 is required for the proper subcellular localization of claudin 1 and 7: implications in the pathogenesis of gelatinous drop-like corneal dystrophy. Am. J. Pathol. (0002-9440) 2010 imex curation Nakatsukasa M., Kawasaki S., Yamasaki K., Fukuoka H., Matsuda A., Tsujikawa M., Tanioka H., Nagata-Takaoka M., Hamuro J., Kinoshita S. Affinomics - Interactions curated for the Affinomics consortium. Cannot see Supplement - although I can get FREE access to the main body of this paper via PubMed, there is no link to the Supplement here; we do not appear to have a subscription to this journal. However I do not think there is anything to annotate from reading text, as all results appear to be negative.... bluenova@koto.kpu-m.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hce-t-15 Human HCE-T-15 Immortalised Corneal Epithelium cell line hce-t-15 Human HCE-T-15 Immortalised Corneal Epithelium cell line subclone of HCE-T (SV40-immortalized human corneal epithelium cell line.) It shows high epithelial barrier function, and expresses the same set of TJ-related proteins as corneal epithelium in vivo. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nakatsukasa M., Kawasaki S., Yamasaki K., Fukuoka H., Matsuda A., Tsujikawa M., Tanioka H., Nagata-Takaoka M., Hamuro J., Kinoshita S. Affinomics - Interactions curated for the Affinomics consortium. Cannot see Supplement - although I can get FREE access to the main body of this paper via PubMed, there is no link to the Supplement here; we do not appear to have a subscription to this journal. However I do not think there is anything to annotate from reading text, as all results appear to be negative.... bluenova@koto.kpu-m.ac.jp Accepted 2014-APR-11 by ORCHARD Am. J. Pathol. (0002-9440) 2010 Only protein-protein interactions imex curation cld7_human Claudin-7 CLDN7 CEPTRL2 CPETRL2 protein protein human Homo sapiens Human MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV 7F3CC1B963D9006A tacd2_human Tumor-associated calcium signal transducer 2 TACSTD2 GA733-1 M1S1 TROP2 Cell surface glycoprotein Trop-2 Membrane component chromosome 1 surface marker 1 Pancreatic carcinoma marker protein GA733-1 protein protein human Homo sapiens Human MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL C8081FBE1D0B9F73 cld4_human Claudin-4 CLDN4 CPER CPETR1 WBSCR8 Clostridium perfringens enterotoxin receptor Williams-Beuren syndrome chromosomal region 8 protein protein protein human Homo sapiens Human MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV 0659A93AA5F0E4C5 zo1_human Tight junction protein ZO-1 TJP1 ZO1 Zonula occludens protein 1 Zona occludens protein 1 Tight junction protein 1 protein protein human Homo sapiens Human MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPDPEPVSDNEEDSYDEEIHDPRSGRSGVVNRRSEKIWPRDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSRDEERISKPGAVSTPVKHADDHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQPIHRIDSPGFKPASQQKAEASSPVPYLSPETNPASSTSAVNHNVNLTNVRLEEPTPAPSTSYSPQADSLRTPSTEAAHIMLRDQEPSLSSHVDPTKVYRKDPYPEEMMRQNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESSSYTDQFSRNYEHRLRYEDRVPMYEEQWSYYDDKQPYPSRPPFDNQHSQDLDSRQHPEESSERGYFPRFEEPAPLSYDSRPRYEQAPRASALRHEEQPAPGYDTHGRLRPEAQPHPSAGPKPAESKQYFEQYSRSYEQVPPQGFTSRAGHFEPLHGAAAVPPLIPSSQHKPEALPSNTKPLPPPPTQTEEEEDPAMKPQSVLTRVKMFENKRSASLETKKDVNDTGSFKPPEVASKPSGAPIIGPKPTSQNQFSEHDKTLYRIPEPQKPQLKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIAASHLSEPAKPAHSQNQSNFSSYSSKGKPPEADGVDRSFGEKRYEPIQATPPPPPLPSQYAQPSQPVTSASLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYPQKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF 189E31617084C0CC cld1_human Claudin-1 Senescence-associated epithelial membrane protein CLDN1 CLD1 SEMP1 UNQ481/PRO944 protein protein human Homo sapiens Human MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV 07269000E6C214F0 tacstd2-cldn1 2 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait association association 2A cldn7-cldn1 1 4 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2B/C cldn1-cldn7 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2B/Ci cldn7-tacstd2 1 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2B/Cii cldn1-tacstd2 1 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2B