IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PTPIP51-a myeloid lineage specific protein interacts with PTP1B in neutrophil granulocytes. PTPIP51-a myeloid lineage specific protein interacts with PTP1B in neutrophil granulocytes. Blood Cells Mol. Dis. (1079-9796) 2010 imex curation Brobeil A., Graf M., Oeschger S., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. Alexander.Brobeil@anatomie.med.uni-giessen.de 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-neutrophil Homo sapiens polymorphonuclear neutrophil neutrophil Neutrophil [Neutrophilic granulocyte] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Brobeil A., Graf M., Oeschger S., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. Cells were from peripheral venous blood and umbilical cord blood. Alexander.Brobeil@anatomie.med.uni-giessen.de Accepted 2015-JAN-06 by PPORRAS Blood Cells Mol. Dis. (1079-9796) 2010 Only protein-protein interactions imex curation PTPIP51-a myeloid lineage specific protein interacts with PTP1B in neutrophil granulocytes. PTPIP51-a myeloid lineage specific protein interacts with PTP1B in neutrophil granulocytes. Blood Cells Mol. Dis. (1079-9796) 2010 imex curation Brobeil A., Graf M., Oeschger S., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. Alexander.Brobeil@anatomie.med.uni-giessen.de 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-neutrophil Homo sapiens polymorphonuclear neutrophil neutrophil Neutrophil [Neutrophilic granulocyte] fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Brobeil A., Graf M., Oeschger S., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. Cells were from peripheral venous blood and umbilical cord blood. Alexander.Brobeil@anatomie.med.uni-giessen.de Accepted 2015-JAN-06 by PPORRAS Blood Cells Mol. Dis. (1079-9796) 2010 Only protein-protein interactions imex curation rmd3_human Regulator of microtubule dynamics protein 3 Protein tyrosine phosphatase-interacting protein 51 TCPTP-interacting protein 51 UNQ3122/PRO10274 hucep-10 RMDN3 Cerebral protein 10 FAM82A2 FAM82C PTPIP51 Protein FAM82A2 Protein FAM82C protein protein human Homo sapiens Human MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGEVRCHMEENQRVARRRRFPFVRERSDSTGSSSVYFTASSGATFTDAESEGGYTTANAESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKEHVDKAIALQPENPMAHFLLGRWCYQVSHLSWLEKKTATALLESPLSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLALELPDVTKEDLAIQKDLEELEVILRD 1C8D1022E6CF7B6A ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT DIP protein P18031 original sequence version: 141 DIP protein P18031 original sequence version: 191 802377DCD33F41FD ptpn1-rmdn3-1 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 7 D/H ptpn1-rmdn3-2 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 8 A