DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ alejo-2006-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262793X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262794X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-7 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262814X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-8 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262795X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-11 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262796X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-13 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262797X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-16 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262809X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-22 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262810X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-25 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262811X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-26 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262813X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-27 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262812X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation ccl20_human C-C motif chemokine 20 CCL20 LARC MIP3A SCYA20 Beta-chemokine exodus-1 CC chemokine LARC Liver and activation-regulated chemokine Macrophage inflammatory protein 3 alpha Small-inducible cytokine A20 protein protein human Homo sapiens Human MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM crmb_var67 Cytokine response-modifying protein B CRMB Viral tumor necrosis factor receptor II G2R G4R protein protein varv Variola virus (isolate Human/India/Ind3/1967) VARV Smallpox virus MKSVLYLYILFLSCIIINGRDAAPYTPPNGKCKDTEYKRHNLCCLSCPPGTYASRLCDSKTNTQCTPCGSGTFTSRNNHLPACLSCNGRCNSNQVETRSCNTTHNRICECSPGYYCLLKGSSGCKACVSQTKCGIGYGVSGHTSVGDVICSPCGFGTYSHTVSSADKCEPVPNNTFNYIDVEITLYPVNDTSCTRTTTTGLSESILTSELTITMNHTDCNPVFREEYFSVLNKVATSGFFTGENRYQNISKVCTLNFEIKCNNKGSSFKQLTKAKNDDGMMSHSETVTLAGDCLSSVDIYILYSNTNAQDYETDTISYRVGNVLDDDSHMPGSCNIHKPITNSKPTRFL tnfa_human Tumor necrosis factor TNF TNFA TNFSF2 TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin protein protein human Homo sapiens Human MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL xcl1_human Lymphotactin XCL1 ATAC C motif chemokine 1 Cytokine SCM-1 LTN Lymphotaxin SCM-1-alpha SCYC1 Small-inducible cytokine C1 XC chemokine ligand 1 protein protein human Homo sapiens Human MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG cxl13_human C-X-C motif chemokine 13 Small-inducible cytokine B13 B lymphocyte chemoattractant CXC chemokine BLC B cell-attracting chemokine 1 CXCL13 BCA1 BLC SCYB13 Angie protein protein human Homo sapiens Human MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP ccl25_human C-C motif chemokine 25 CCL25 SCYA25 TECK Small-inducible cytokine A25 Thymus-expressed chemokine Chemokine TECK protein protein human Homo sapiens Human MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL mint Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1 ccl28_human C-C motif chemokine 28 Mucosae-associated epithelial chemokine CCL28 SCYA28 Small-inducible cytokine A28 Protein CCK1 protein protein human Homo sapiens Human MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner mint tnfb_human Lymphotoxin-alpha TNF-beta Tumor necrosis factor ligand superfamily member 1 LTA TNFB TNFSF1 protein protein human Homo sapiens Human MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL sdf1_human Stromal cell-derived factor 1 CXCL12 SDF1 SDF1A SDF1B C-X-C motif chemokine 12 Intercrine reduced in hepatomas Pre-B cell growth-stimulating factor protein protein human Homo sapiens Human MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM tnfa_mouse Tumor necrosis factor TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin Tnf Tnfa Tnfsf2 protein protein mouse Mus musculus Mouse MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL cxl14_human C-X-C motif chemokine 14 MIP2G NJAC SCYB14 Chemokine BRAK MIP-2G Small-inducible cytokine B14 UNQ240/PRO273 PSEC0212 CXCL14 protein protein human Homo sapiens Human MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE tnfa_rat Tumor necrosis factor TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin Tnf Tnfa Tnfsf2 protein protein rat Rattus norvegicus (Rat) Rat MSTESMIRDVELAEEALPKKMGGLQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPNKEEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL crmb-tnf-1 3143071 N/A 3143099 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-tnf-2 3143074 N/A 3143105 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-cxcl14-1 3143077 N/A 3143108 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-tnf-3 3143078 N/A 3143109 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-lta-1 3143081 N/A 3143112 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-ccl25-1 3143083 N/A 3143114 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait Region 194-348 Region 194-348 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-ccl28-1 3143086 N/A 3143113 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-ccl20-1 3143092 N/A 3143102 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-xcl1-1 3143095 N/A 3143118 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-cxcl13-1 3143096 N/A 3143116 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false crmb-cxcl12-1 3143097 N/A 3143111 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143100 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint renatus-2000-1 Crystal structure of the apoptotic suppressor CrmA in its cleaved form. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Renatus M., Zhou Q., Stennicke HR., Snipas SJ., Turk D., Bankston LA., Liddington RC., Salvesen GS. Virus - Publications including interactions involving viral proteins Structure (0969-2126) 2000 spi2_var67 Serine proteinase inhibitor 2 SPI-2 B13R B12R B14R protein protein varv Variola virus (isolate Human/India/Ind3/1967) VARV Smallpox virus MDIFREIASSTKGENVFISPATISSVLTILYYGANGSTAEQLSKYVEKEETMDKVSAQNISFKSMNKVYGRYSAVFKNSFLGKIGDNFQTVDFTDCRTIDAINKCVDVFTEGKINPLLTEQLSPNTCLLAISAVYFKAKWLIPFKKEFTSDYPFYVSPTEMVDVSMMSMYGESFNYASVKESFGNFSIIELPYVGNTSMMVILPDKIDGLESIKQNLTDTNFKKWCNSLEATFIDVHIPKFKVTGSYNLVDTLVKLGLTDVFYSTGDYSNMCNSDVSVDAMIHKTYIDVNEEYTEAAAATSVLVADCASTVTNEFCADHPFIYVIRHVDGKILFVGRYCSPTTN mint May be involved in the regulation of the complement cascade spi2_cwpxb Serine proteinase inhibitor 2 CRMA SPI-2 CPXV207 ICE inhibitor Cytokine response modifier protein A Hemorrhage-inducing 38 kDa protein protein protein cpv Cowpox virus (strain Brighton Red) MDIFREIASSMKGENVFISPPSISSVLTILYYGANGSTAEQLSKYVEKEADKNKDDISFKSMNKVYGRYSAVFKDSFLRKIGDNFQTVDFTDCRTVDAINKCVDIFTEGKINPLLDEPLSPDTCLLAISAVYFKAKWLMPFEKEFTSDYPFYVSPTEMVDVSMMSMYGEAFNHASVKESFGNFSIIELPYVGDTSMVVILPDNIDGLESIEQNLTDTNFKKWCDSMDAMFIDVHIPKFKVTGSYNLVDALVKLGLTEVFGSTGDYSNMCNSDVSVDAMIHKTYIDVNEEYTEAAAATCALVADCASTVTNEFCADHPFIYVIRHVDGKILFVGRYCSPTTN mint Specific and potent inhibitor of the interleukin-1-beta converting enzyme (ICE) thereby suppressing an interleukin-1 beta response to infection. The inhibition of ICE by crmA is an example of a "cross-class" interaction, in which a serpin inhibits a non-serine proteinase. Also inhibits granzyme B crma-spi_2 100365 spi2_cwpxb 100366 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 spi2_varv 100367 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false In the xray complex 1f0c, P07385 is chain A and P33830 is chain B Resolution 2.260 homomint mint