MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint yuchi-2009-1 An engineered right-handed coiled coil domain imparts extreme thermostability to the KcsA channel. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Yuchi Z., Pau VP., Lu BX., Junop M., Yang DS. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation yuchi-2009-2 An engineered right-handed coiled coil domain imparts extreme thermostability to the KcsA channel. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yuchi Z., Pau VP., Lu BX., Junop M., Yang DS. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation kcsa_strli pH-gated potassium channel KcsA Streptomyces lividans K+ channel kcsA skc1 protein protein strli Streptomyces lividans MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR mint kcsa 853619 kcsa_strli kcsA 853621 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false mint f4B kcsa-1 853620 kcsa_strli kcsA 853621 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false mint f4A DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cuello-2010-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Perozo E. DIP original experiment: DIP-219432X Nature 2010 IMEx Structural mechanism of C-type inactivation in K(+) channels. Cuello LG., Jogini V., Cortes DM., Perozo E. Only protein-protein interactions imex curation thompson-2009-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Thompson AN., Kim I., Panosian TD., Iverson TM., Allen TW., Nimigean CM. DIP original experiment: DIP-133355X Nature structural & molecular biology 2009 IMEx Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore. Thompson AN., Kim I., Panosian TD., Iverson TM., Allen TW., Nimigean CM. Only protein-protein interactions imex curation matulef-2016-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Matulef K., Annen AW., Nix JC., Valiyaveetil FI. DIP original experiment: DIP-268512X Structure (London, England : 1993) 2016 IMEx Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation. Matulef K., Annen AW., Nix JC., Valiyaveetil FI. Only protein-protein interactions imex curation matulef-2016-2 in vitro In vitro comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Matulef K., Annen AW., Nix JC., Valiyaveetil FI. DIP original experiment: DIP-268513X Structure (London, England : 1993) 2016 IMEx Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation. Matulef K., Annen AW., Nix JC., Valiyaveetil FI. Only protein-protein interactions imex curation matulef-2016-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Matulef K., Annen AW., Nix JC., Valiyaveetil FI. DIP original experiment: DIP-268514X Structure (London, England : 1993) 2016 IMEx Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation. Matulef K., Annen AW., Nix JC., Valiyaveetil FI. Only protein-protein interactions imex curation ma-2008-7 ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Ma D., Tillman TS., Tang P., Meirovitch E., Eckenhoff R., Carnini A., Xu Y. DIP original experiment: DIP-113735X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx NMR studies of a channel protein without membranes: structure and dynamics of water-solubilized KcsA. Ma D., Tillman TS., Tang P., Meirovitch E., Eckenhoff R., Carnini A., Xu Y. Only protein-protein interactions imex curation ma-2008-8 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Ma D., Tillman TS., Tang P., Meirovitch E., Eckenhoff R., Carnini A., Xu Y. DIP original experiment: DIP-113736X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx NMR studies of a channel protein without membranes: structure and dynamics of water-solubilized KcsA. Ma D., Tillman TS., Tang P., Meirovitch E., Eckenhoff R., Carnini A., Xu Y. Only protein-protein interactions imex curation ma-2008-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ma D., Tillman TS., Tang P., Meirovitch E., Eckenhoff R., Carnini A., Xu Y. DIP original experiment: DIP-113737X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx NMR studies of a channel protein without membranes: structure and dynamics of water-solubilized KcsA. Ma D., Tillman TS., Tang P., Meirovitch E., Eckenhoff R., Carnini A., Xu Y. Only protein-protein interactions imex curation cheng-2011-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cheng WW., McCoy JG., Thompson AN., Nichols CG., Nimigean CM. DIP original experiment: DIP-250965X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Mechanism for selectivity-inactivation coupling in KcsA potassium channels. Cheng WW., McCoy JG., Thompson AN., Nichols CG., Nimigean CM. Only protein-protein interactions imex curation uysal-2011-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. DIP original experiment: DIP-249632X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Mechanism of activation gating in the full-length KcsA K+ channel. Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. Only protein-protein interactions imex curation uysal-2011-2 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. DIP original experiment: DIP-249633X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Mechanism of activation gating in the full-length KcsA K+ channel. Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. Only protein-protein interactions imex curation uysal-2011-3 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. DIP original experiment: DIP-249636X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Mechanism of activation gating in the full-length KcsA K+ channel. Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. Only protein-protein interactions imex curation uysal-2011-4 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. DIP original experiment: DIP-249637X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Mechanism of activation gating in the full-length KcsA K+ channel. Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. Only protein-protein interactions imex curation uysal-2011-5 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. DIP original experiment: DIP-249634X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Mechanism of activation gating in the full-length KcsA K+ channel. Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. Only protein-protein interactions imex curation uysal-2011-6 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. DIP original experiment: DIP-249635X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Mechanism of activation gating in the full-length KcsA K+ channel. Uysal S., Cuello LG., Cortes DM., Koide S., Kossiakoff AA., Perozo E. Only protein-protein interactions imex curation cuello-2010-2 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219449X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219443X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-4 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219446X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-5 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219452X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-6 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219444X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-7 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219450X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-8 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219453X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-9 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219454X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-10 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219447X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-11 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219445X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-12 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219448X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-13 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219451X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation thompson-2008-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Thompson AN., Posson DJ., Parsa PV., Nimigean CM. DIP original experiment: DIP-110977X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular mechanism of pH sensing in KcsA potassium channels. Thompson AN., Posson DJ., Parsa PV., Nimigean CM. Only protein-protein interactions imex curation thompson-2008-2 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Thompson AN., Posson DJ., Parsa PV., Nimigean CM. DIP original experiment: DIP-110978X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular mechanism of pH sensing in KcsA potassium channels. Thompson AN., Posson DJ., Parsa PV., Nimigean CM. Only protein-protein interactions imex curation uysal-2009-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Uysal S., Vásquez V., Tereshko V., Esaki K., Fellouse FA., Sidhu SS., Koide S., Perozo E., Kossiakoff A. DIP original experiment: DIP-134110X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of full-length KcsA in its closed conformation. Uysal S., Vásquez V., Tereshko V., Esaki K., Fellouse FA., Sidhu SS., Koide S., Perozo E., Kossiakoff A. Only protein-protein interactions imex curation raghuraman-2012-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Raghuraman H., Cordero-Morales JF., Jogini V., Pan AC., Kollewe A., Roux B., Perozo E. DIP original experiment: DIP-250506X Structure (London, England : 1993) 2012 IMEx Mechanism of Cd2+ coordination during slow inactivation in potassium channels. Raghuraman H., Cordero-Morales JF., Jogini V., Pan AC., Kollewe A., Roux B., Perozo E. Only protein-protein interactions imex curation raghuraman-2012-2 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Raghuraman H., Cordero-Morales JF., Jogini V., Pan AC., Kollewe A., Roux B., Perozo E. DIP original experiment: DIP-250507X Structure (London, England : 1993) 2012 IMEx Mechanism of Cd2+ coordination during slow inactivation in potassium channels. Raghuraman H., Cordero-Morales JF., Jogini V., Pan AC., Kollewe A., Roux B., Perozo E. Only protein-protein interactions imex curation baker-2007-2 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. DIP original experiment: DIP-68102X Nature structural & molecular biology 2007 IMEx Conformational dynamics of the KcsA potassium channel governs gating properties. Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. Only protein-protein interactions imex curation baker-2007-3 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. DIP original experiment: DIP-68103X Nature structural & molecular biology 2007 IMEx Conformational dynamics of the KcsA potassium channel governs gating properties. Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. Only protein-protein interactions imex curation cordero_morales-2007-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cordero-Morales JF., Jogini V., Lewis A., Vásquez V., Cortes DM., Roux B., Perozo E. DIP original experiment: DIP-68104X Nature structural & molecular biology 2007 IMEx Molecular driving forces determining potassium channel slow inactivation. Cordero-Morales JF., Jogini V., Lewis A., Vásquez V., Cortes DM., Roux B., Perozo E. Only protein-protein interactions imex curation kcsa_strli pH-gated potassium channel KcsA Streptomyces lividans K+ channel kcsA skc1 protein protein strli Streptomyces lividans MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR mint kcsa-12 3210957 N/A 3210958 unspecified role unspecified role unspecified role unspecified role region 21-160 region 21-160 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-11 3199656 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 1-124 Region 1-124 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-32 3291567 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 1-125 Region 1-125 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-33 3291568 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 1-125 Region 1-125 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-36 3291569 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 1-125 Region 1-125 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-7 3179085 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 22-124 Region 22-124 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-8 3179086 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 22-124 Region 22-124 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-9 3179087 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 22-124 Region 22-124 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-25 3223422 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 2-124 Region 2-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P0A334:p.Glu71Ala E71A mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-26 3228036 N/A 3210958 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false kcsa-27 3228037 N/A 3210958 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-28 3228038 N/A 3210958 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-29 3228039 N/A 3210958 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-30 3228040 N/A 3210958 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-31 3228041 N/A 3210958 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-13 3211035 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-14 3211036 N/A 3210958 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false kcsa-15 3211037 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-16 3211038 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-17 3211039 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 1-124 Region 1-124 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-18 3211040 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-19 3211041 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-20 3211042 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-21 3211043 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-22 3211044 N/A 3210958 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Alexa488-label Alexa488-label alexa 488 label alexa 488 label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3210958 unspecified role unspecified role fluorescence donor fluorescence donor Alexa350-label Alexa350-label alexa 350 label alexa 350 label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-23 3211045 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-24 3211046 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-5 3170851 N/A 3210958 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false kcsa-6 3170852 N/A 3210958 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false kcsa-10 3186725 N/A 3210958 unspecified role unspecified role unspecified role unspecified role Region 129-158 Region 129-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-34 3242299 N/A 3210958 unspecified role unspecified role unspecified role unspecified role P0A334:p.Tyr82Cys Y82C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-35 3242300 N/A 3210958 unspecified role unspecified role unspecified role unspecified role MTSSL-label MTSSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-2 3162429 N/A 3210958 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false kcsa-3 3162430 N/A 3210958 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false kcsa-4 3162436 N/A 3210958 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false