mpidb The Microbial Protein Interaction Database xu-2008-1 A cellulose synthase-like protein involved in hyphal tip growth and morphological differentiation in streptomyces. ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase inferred by author inferred by author modeled by author modelled by author Xu H., Chater K.F., Deng Z., Tao M. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation letek-2008-1 DivIVA is required for polar growth in the MreB-lacking rod-shaped actinomycete Corynebacterium glutamicum. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Letek M., Ordóñez E., Vaquera J., Margolin W., Flärdh K., Mateos L.M., Gil J.A. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation kim-2008g-1 Complex extracellular interactions of proteases and a protease inhibitor influence multicellular development of Streptomyces coelicolor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kim D.W., Hesketh A., Kim E.S., Song J.Y., Lee D.H., Kim I.S., Chater K.F., Lee K.J. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation kim-2008g-2 Complex extracellular interactions of proteases and a protease inhibitor influence multicellular development of Streptomyces coelicolor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim D.W., Hesketh A., Kim E.S., Song J.Y., Lee D.H., Kim I.S., Chater K.F., Lee K.J. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation kim-2008g-3 Complex extracellular interactions of proteases and a protease inhibitor influence multicellular development of Streptomyces coelicolor. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by staining molecular weight estimation by staining weight by staining Kim D.W., Hesketh A., Kim E.S., Song J.Y., Lee D.H., Kim I.S., Chater K.F., Lee K.J. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation kim-2008g-4 Complex extracellular interactions of proteases and a protease inhibitor influence multicellular development of Streptomyces coelicolor. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim D.W., Hesketh A., Kim E.S., Song J.Y., Lee D.H., Kim I.S., Chater K.F., Lee K.J. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation parashar-2009-1 BldG and SCO3548 interact antagonistically to control key developmental processes in Streptomyces coelicolor. ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Parashar A., Colvin K.R., Bignell D.R., Leskiw B.K. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation parashar-2009-3 BldG and SCO3548 interact antagonistically to control key developmental processes in Streptomyces coelicolor. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Parashar A., Colvin K.R., Bignell D.R., Leskiw B.K. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation parashar-2009-2 BldG and SCO3548 interact antagonistically to control key developmental processes in Streptomyces coelicolor. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Parashar A., Colvin K.R., Bignell D.R., Leskiw B.K. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation kim-2008f-1 A possible extended family of regulators of sigma factor activity in Streptomyces coelicolor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim E.S., Song J.Y., Kim D.W., Chater K.F., Lee K.J. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation kim-2008f-2 A possible extended family of regulators of sigma factor activity in Streptomyces coelicolor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kim E.S., Song J.Y., Kim D.W., Chater K.F., Lee K.J. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation kim-2008f-3 A possible extended family of regulators of sigma factor activity in Streptomyces coelicolor. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kim E.S., Song J.Y., Kim D.W., Chater K.F., Lee K.J. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation sevcikova-2010-2 The anti-anti-sigma factor BldG is involved in activation of the stress response sigma factor σ(H) in Streptomyces coelicolor A3(2). ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Sevcikova B., Rezuchova B., Homerova D., Kormanec J. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation sevcikova-2010-3 The anti-anti-sigma factor BldG is involved in activation of the stress response sigma factor σ(H) in Streptomyces coelicolor A3(2). in vitro In vitro bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Sevcikova B., Rezuchova B., Homerova D., Kormanec J. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation sevcikova-2010-1 The anti-anti-sigma factor BldG is involved in activation of the stress response sigma factor σ(H) in Streptomyces coelicolor A3(2). in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Sevcikova B., Rezuchova B., Homerova D., Kormanec J. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation q8nnn8_corgl Antigen 84 Cell wall synthesis protein Wag31 Cgl2150 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MPLTPADVHNVAFNKPPIGKRGYNEDEVDQFLDLVEDALVQFQEENEDLKQQVEELEAQVAGGTSSAASSSTAGAATAAASKSVDEAALRKEIEEKLRSEYASKLDDASKAAQKAQNDAKSAQDQLQRAQADAKAARDEAEKAKAEAKSAASSSTTKAAAVGAVGAGTGAAVATGAANVDTHMQAAKVLGLAQEMADRLTSEARSESKSMLDEAREAAEKQIEEANSTSNRTLEDARANAEKQIAEAQNRADTLVNEADAKAKNLVSEAEKKSAATLAASTSRAEAQIRQAEDKANALQADAERKHTETMAAVKEQQNALETRIAELQTFEREYRTRLKSLLEGQLEELNARGSSAPTNNKPSGE div4a_strr6 Cell division protein DivIVA divIVA spr1505 protein protein strr6 Streptococcus pneumoniae (strain ATCC BAA-255 / R6) MPITSLEIKDKTFGTRFRGFDPEEVDEFLDIVVRDYEDLVRANHDKNLRIKSLEERLSYFDEIKDSLSQSVLIAQDTAERVKQAAHERSNNIIHQAEQDAQRLLEEAKYKANEILRQATDNAKKVAVETEELKNKSRVFHQRLKSTIESQLAIVESSDWEDILRPTATYLQTSDEAFKEVVSEVLGEPIPAPIEEEPIDMTRQFSQAEMEELQARIEVADKELSEFEAQIKQEVETPTPVVSPQVEEEPLLIQLAQCMKNQK div4a_bacsu Septum site-determining protein DivIVA ylmJ Cell division initiation protein DivIVA Minicell-associated protein DivIVA BSU15420 divIVA protein protein bacsu Bacillus subtilis MPLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHFANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKNADRIINESLSKSRKIAMEIEELKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYEVDAVFEEKE wag31_myctu Cell wall synthesis protein Wag31 wag31 Antigen 84 ag84 MTCY270.23 Rv2145c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNTAKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKADALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDSNADAGGFDQFNRGKN q9rdb5_strco SCO2836 protein protein strco Streptomyces coelicolor A3(2) MTSTPTGAGPDHDPSQTTQLRVPGHRNWNTGSFRRIKKTLPKYDYEHYSRLAGPLTQPDPNKPYRVQYRSLISQEPHRLRVALMLAAAPLLSVVLLVWLLQPEHWTERDYVAFDWLPALDIVMLVAIGLIELFRCLNVLSNAHATLVARDPVPVVPETGTKVAFLTSFVPGKEPLEMVTKTLEAAVRIRHRGLMHVWLLDEGDDPEVKEVCARLGVHHFSRKGVAKWNRKKGPHRAKTKHGNYNAWLDAHGDDYDFFASVDTDHVPLPNYLERMLGFFRDPDVGFVIGPQVYGNYDNPITKAAESQQFLFHALIQRAGNRYGGPMFVGTSNAVRIRALKQIGGLYDSITEDMATGFEMHRHKNPATGRKWRSVYTPDVLAVGEGPNAWTDFFTQQMRWSRGTYETILKQYWKGWYSLPPSKLFNYTMMIIFYPMSALNWILAALSCCLFLGLGASGVNIDPAVWLMLYGNASALQIGLYVWNRRHNVSPHEPEGSGGVAGMIMSALSAPLYAKALIDSVLRRKSKFVVTPKGDSASPDTLFGTFRYHWYFIVIFGGSIAAGFVYGHSHPAMIIWATFALLITASPMFAWRHELRKAKKQPPVAAAEPAPRVPPQQAPYGRHTPQHRPDWAAPADGGDDQTMQIALGGLGGRKE q9s2x4_strco Antigen 84 Cell wall synthesis protein Wag31 SCO2077 protein protein strco Streptomyces coelicolor A3(2) MPLTPEDVRNKQFTTVRLREGYDEDEVDAFLDEVEAELTRLLRENEDLRAKLAAATRAAAQNQQNMRKPPEPPQDQQHQQGPPQHQQGPPQQGGMPQQGMRGPGAPVPAGISGPPQQQMGGPMGGPPQLPSGAPQLPAGPGGQGGPQGPGPMGQGPGPMGQGPGPMQGQMGPGPMGGPMGGPQGPGGPGGPGMPGQGGPGGDSAARVLSLAQQTADQAIAEARSEANKIVGEARSRAEGLERDARAKADALERDAQEKHRVAMGSLESARATLERKVEDLRGFEREYRTRLKSYLESQLRQLETQADDSLAPPRTPATASLPPSPAPSMAPAGASAPSYGGNQSMGGGPGQSGPSYGGQQQMSPAMTQPMAPVRPQGPSPMGQAPSPMRGFLIDEDDN q9l0g5_strco SCO4677 protein protein strco Streptomyces coelicolor A3(2) MNQESTTELTASVRNFSVQLSPTPRGARLARLLATEQLRSWGLPPDPARLLVAELANNAADHGRVPGRDFRLTLYVVGDILRIEVTDTRGQELPAPQKPASDAESGRGLLLVEALAHRWGVTEGRFPRKTVWAELRCTPPEPTF q9rd40_strco SCO0869 protein protein strco Streptomyces coelicolor A3(2) MSVEAEVTVTVVDDVRIVRVAGDYDAVGAETLAHALALPAETGTSGTVVDLAKVTFADSSFLHTLLAAQYRHQTSGIPLVLAEVTPVLQRLLDLTDVTRAFTVAQTVPTATETVHARKSSTRRQ q9ews1_strco Anti-sigma factor antagonist SCO0781 protein protein strco Streptomyces coelicolor A3(2) MSIEHAQTRSIGVTFRADWVVEPPEAGRTGRDRLEARFVRQESASPTRHLRVRHHRGHTVLEFRGEIDIASAAEIAPYLDRETGRPGARVVLDLDGIEFFDCSGLRLLYRARSQVLDGGGQVRLVCTHALTLRMLRITGLARLLPPWPTLDEALGVSRPAGRRTGR rpof_strco RNA polymerase sigma-F factor rpoX 2SCD60.01c SCO4035 sigF protein protein strco Streptomyces coelicolor A3(2) MPASTAPQAPPAPPAQAQAQAPAQAQEAPAPQRSRGADTRALTQVLFGELKGLAPGTPEHDRVRAALIEANLPLVRYAAARFRSRNEPMEDVVQVGTIGLINAIDRFDPERGVQFPTFAMPTVVGEIKRYFRDNVRTVHVPRRLHELWVQVNSATEDLTTAFGRSPTTAEIAERLRITEEEVLSCIEAGRSYHATSLEAAQEGDGLPGLLDRLGYEDPALDGVEHRDLVRHLLVQLPEREQRILLLRYYSNLTQSQISAELGVSQMHVSRLLARSFQRLRSANRIDA q9k3x9_strco SCO1355 protein protein strco Streptomyces coelicolor A3(2) MKLRKFDARAIRGLLAAGATSALLVGAAAVNGAAAPVPPDDRGHIVGADRAGAVEGSYIVTLKDNVARADVPASAKALAKRHGGSLRYTYTTALRGFAVKMTERRAEELAADPSVARVEADAVAYAVGTQPDPPSWGLDRIDQRDLPVDRSYTYPGGAPDVTAYVVDTGVRLSHNDFGGRAVSGYDFIDDDSNASDCQGHGTHVAGTVGGASHGVAKAVRLVGVRVLNCQGTSGNTWAPVLAGIDWVTRNADGPSVANMSIGGGRTQSVNDAVDASVASGVTWVVAAGNNNADACSYSPSSTPAAVTVGATDSRDARASGWSNGQGSNYGSCLDIFAPGDTIVSASNAGDSASRADSGTSMASPHVAGAAALLLSAHPDWSPAQVRDRLVADATSGKVTDPRNGSPNRLLFTGTGDDTQPPTDGERFENTDDHPIRDGATVESPLTVTGVSGNAPADLSVTVDIRHTYRGDLRVELVAPDGDVFLLKDYAAYDGTDDVRGTFAVNASGKPANGTWKLRVSDNWVNDTGHVDAWSLRF q9l1f8_strco Neutral metalloproteinase SCO5447 protein protein strco Streptomyces coelicolor A3(2) MLSSSTPHRRTSHTTSHTSRRTAHRRAAAVALAGVAALIATAVQSGTATAAPDPSPAKGNELVRLSPAQRAELIRDADATKAKTAGELGLGAKEKLVVRDVAKDRDGTLHTRYERTYDGLPVLGGDLVVATDAGKTEQVVKATAKALRPATVTPKISAAKAESQAVSAAKAAGAEQPDADRAPRKVIWAASGTPVLAYETVVGGLQEDGTPNELHVITDAATGAKLYEYQGIENGTGNTLYSGTVTLGTAQSGSSYTLTDTARGNHKTYNLNRGTSGTGTLFSGSDDVWGNGSASNAETAAADAHYGAALTWDYYKNVHGRSGIRGDGVGAYSRVHYGNNYVNAFWQDSCFCMTYGDGSGNANPLTSIDVAAHEMSHGVTSVTAGLNYSGESGGLNEATSDIFATAVEFYANNSSDVGDYLIGEEIDINGDGTPLRYMDKPSKDGASKDSWYSGIGGVDVHYSSGPANHFFYLLSEGSGTKTINGVTYNSPTSDGLPVTGIGRAKAEKIWFRALTTKFTSTTNYAGARTGTLAAAGELYGTDSAEYTAVANAWAGINVGARPGGGDPGDGTTFESTTNVNIPDYGSAVTSSLTVSGRTGNAPSNLQVGVDIEHTWRGDLQIDLVAPDGSTYRLKNSGYDPAEDVHETYTVNASSESANGTWKLRVQDQGPADTGYIDAWRLTFP ssi_strco Subtilase-type protease inhibitor sti1 SCF81.21c SCO0762 protein protein strco Streptomyces coelicolor A3(2) MRNTARWAATLGLTATAVCGPLAGASLASPATAPASLYAPSALVLTVGHGESAATAAPLRAVTLTCAPTASGTHPAAAAACAELRAAHGDPSALAAEDSVMCTREYAPVVVTVDGVWQGRRLSYERTFANECVKNAGSASVFTF q9x914_strco SCO3548 protein protein strco Streptomyces coelicolor A3(2) MATVELRFSALPEHVRTARLVAAAVARRAGVDEAVLDEVRLAVGEACTRAVGLHQHVGITAPVKVSLIEEEKQFSIEVGDEAPHAVPGVKTSGDAVDELEAEEDEMGLAVISGLVDDVEVSAGEDGGLIRMTWPTASAVLPPI rsbv_strco Anti-sigma-B factor antagonist Anti-anti-sigma-B factor SCH5.12c SCO3549 rsbV bldG protein protein strco Streptomyces coelicolor A3(2) MDLSLSTRTVGDRTVVEVGGEIDVYTAPKLREQLVELVNDGSFHLVVDMEGVDFLDSTGLGVLVGGLKRVRAHEGSLRLVCNQERILKIFRITGLTKVFPIHTSVEEAVAATD q9rit0_strco sigH SCO5243 protein protein strco Streptomyces coelicolor A3(2) MRDGDGPVRDEERGTRELPAEGTRSPNEARRTADGIDGIPEQARPHPEDETSPGAAVPGEGQRTGETPVRPVRAEARARERATGGTMSEHERHADGHAPGARGTQGTRHDPQDRSGARLLFAELRTLEKDSPEYAELRNRLVRMHLPLVEHLARRFRNRGEPLDDLTQVATIGLIKSVDRFDPDRGVEFSTYATPTVVGEIKRHFRDKGWAVRVPRRLQELRLALTTATAELSQLHGRSPTVHELAEKLSISEEEVLEGLESANAYSTLSLDVPDTDDESPAVADTLGAEDEALEGVEYRESLKPLLEDLPPREKRILLLRFFGNMTQSQIAQEVGISQMHVSRLLARTLAQLREKLLVEE q9r3x8_strco prsH ushX SCO5244 protein protein strco Streptomyces coelicolor A3(2) MSQIAGEPATQDFVEVRLPAAGAYLSVLRTATAGLAARLDFTLDEIEDLRIAVDEACAILLQQAVPGSVLSCVFRLVDDSLEVTVSAPTTDGHAPSRDTFAWTVLSALAGKVSSAVDEDKTVSISLYKQRGAGPGPT q9rdb5-q9s2x4 1333564 not-defined-1185046266 1333565 unspecified role unspecified role bait bait cytoplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-597015916 1333566 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6 diviva-diviva-7 1333111 n/a 1333112 unspecified role unspecified role prey prey n/a 1333112 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 diviva-diviva-6 1333111 not-defined-1661648702 1333113 unspecified role unspecified role prey prey n/a 1333112 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 q9s2x4-q9s2x4 1333111 not-defined-417314078 1333566 unspecified role unspecified role bait bait not-defined-1230460359 1333566 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q9s2x4-ag84 1333111 not-defined-89118665 1333566 unspecified role unspecified role bait bait not-defined-1648223020 1333115 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q9s2x4-q8nnn8 1333111 not-defined-1253434428 1333116 unspecified role unspecified role prey prey not-defined-408876655 1333566 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 ag84-q9s2x4 1333111 not-defined-1823291516 1333115 unspecified role unspecified role bait bait not-defined-507975401 1333566 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ag84-ag84 1333111 not-defined-883135924 1333115 unspecified role unspecified role bait bait not-defined-549662402 1333115 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ag84-q8nnn8 1333111 not-defined-1481067254 1333115 unspecified role unspecified role bait bait not-defined-789649591 1333116 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 diviva-diviva-8 1333111 not-defined-1553661763 1333113 unspecified role unspecified role bait bait n/a 1333112 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 diviva-diviva-4 1333111 not-defined-2064192807 1333113 unspecified role unspecified role prey prey not-defined-378808346 1333113 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 q8nnn8-q8nnn8 1333111 not-defined-367605425 1333116 unspecified role unspecified role bait bait not-defined-1453265009 1333116 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q8nnn8-ag84 1333111 not-defined-1991932857 1333116 unspecified role unspecified role bait bait not-defined-877198157 1333115 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q8nnn8-q9s2x4 1333111 not-defined-1434329389 1333566 unspecified role unspecified role prey prey not-defined-1260131744 1333116 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 sti1-q9k3x9 1334335 not-defined-1523865461 1334339 inhibitor inhibitor bait bait not-defined-187570978 1334340 enzyme enzyme prey prey physical association physical association false false false sti1-q9l1f8 1334335 not-defined-971520784 1334341 enzyme enzyme prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1715658202 1334339 inhibitor inhibitor bait bait physical association physical association false false false Fig. 6A q9k3x9-sti1 1334336 not-defined-1328586984 1334339 unspecified role unspecified role prey prey not-defined-1208988084 1334340 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6B sti1-q9k3x9-1 1334336 not-defined-1236129830 1334339 unspecified role unspecified role bait bait not-defined-378112923 1334340 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6B o54109-q9k3x9 1334337 n/a 1334339 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1679330310 1334340 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false q9k3x9-sti1-1 1334338 n/a 1334339 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1679330310 1334340 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false q9x914-q9x914 1335420 not-defined-1371845551 1335423 unspecified role unspecified role prey prey not-defined-956626386 1335423 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4B rsbv-rsbv 1335420 not-defined-2127501521 1335424 unspecified role unspecified role prey prey not-defined-1005653638 1335424 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4A rsbv-q9x914 1335420 not-defined-15929326 1335424 unspecified role unspecified role bait bait not-defined-1062086777 1335423 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1 q9x914-rsbv 1335420 not-defined-806413734 1335424 unspecified role unspecified role prey prey not-defined-620119766 1335423 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1 q9x914-q9x914-1 1335421 not-defined-94034186 1335423 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-64343935 1335423 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false Fig. 5A q9x914-rsbv-2 1335421 not-defined-15929326 1335424 unspecified role unspecified role prey prey ecolx Escherichia coli not-defined-1062086777 1335423 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 2B rsbv-rsbv-1 1335421 not-defined-1005653638 1335424 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-2127501521 1335424 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false Fig. 5B rsbv-q9x914-2 1335422 not-defined-1062086777 1335423 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-15929326 1335424 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 2A q9l0g5-q9rd40-1 1334170 not-defined-830889806 1334173 unspecified role unspecified role bait bait not-defined-1058468144 1334174 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5A q9l0g5-q9ews1-1 1334170 not-defined-816335455 1334175 unspecified role unspecified role prey prey not-defined-341410293 1334173 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5A q9l0g5-sigf 1334170 not-defined-257329223 1334173 unspecified role unspecified role bait bait not-defined-1475637831 1334176 unspecified role unspecified role prey prey physical association physical association false false false Fig 4A sigf-q9l0g5 1334170 not-defined-1201471572 1334173 unspecified role unspecified role prey prey not-defined-2043701510 1334176 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4A q9l0g5-q9ews1 1334171 not-defined-1577988034 1334175 unspecified role unspecified role prey prey not-defined-1478618838 1334173 unspecified role unspecified role bait bait physical association physical association false false false q9l0g5-q9rd40 1334171 not-defined-2133970399 1334174 unspecified role unspecified role prey prey not-defined-92773990 1334173 unspecified role unspecified role bait bait physical association physical association false false false q9l0g5-q9rd40-2 1334172 not-defined-1728502444 1334174 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-900039624 1334173 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 8A rsbv-q9x914-1 1337789 not-defined-328843392 1335424 unspecified role unspecified role bait bait not-defined-1716908147 1335423 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 sigh-prsh 1337789 not-defined-1489588342 1337794 unspecified role unspecified role bait bait not-defined-1531391623 1337795 unspecified role unspecified role prey prey physical association physical association false false false figure 2 rsbv-prsh 1337789 not-defined-1787085007 1335424 unspecified role unspecified role bait bait not-defined-790319911 1337795 unspecified role unspecified role prey prey physical association physical association false false false figure 2 q9x914-rsbv-1 1337790 not-defined-555306992 1335424 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli not-defined-749879377 1335423 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association false false false Figure 3 prsh-rsbv-1 1337790 not-defined-1542319913 1335424 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli not-defined-944281084 1337795 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association false false false Figure 3 prsh-rsbv 1337791 not-defined-942285885 1337795 unspecified role unspecified role bait bait q9r3x8-- Q9R3X8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) not-defined-749123324 1335424 unspecified role unspecified role prey prey strco Streptomyces coelicolor A3(2) physical association physical association false false false Figure 1 IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ keatinge_cl-2004-1 An antibiotic factory caught in action. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Keatinge-Clay AT., Maltby DA., Medzihradszky KF., Khosla C., Stroud RM. PDBe - Data obtained from the Protein Data Bank Europe Nat. Struct. Mol. Biol. (1545-9993) 2004 acti2_strco Actinorhodin polyketide putative beta-ketoacyl synthase 2 SCO5088 SCBAC28G1.14 actI ORF2 protein protein strco Streptomyces coelicolor A3(2) MSVLITGVGVVAPNGLGLAPYWSAVLDGRHGLGPVTRFDVSRYPATLAGQIDDFHAPDHIPGRLLPQTDPSTRLALTAADWALQDAKADPESLTDYDMGVVTANACGGFDFTHREFRKLWSEGPKSVSVYESFAWFYAVNTGQISIRHGMRGPSSALVAEQAGGLDALGHARRTIRRGTPLVVSGGVDSALDPWGWVSQIASGRISTATDPDRAYLPFDERAAGYVPGEGGAILVLEDSAAAEARGRHDAYGELAGCASTFDPAPGSGRPAGLERAIRLALNDAGTGPEDVDVVFADGAGVPELDAAEARAIGRVFGREGVPVTVPKTTTGRLYSGGGPLDVVTALMSLREGVIAPTAGVTSVPREYGIDLVLGEPRSTAPRTALVLARGRWGFNSAAVLRRFAPTP acti1_strco Actinorhodin polyketide putative beta-ketoacyl synthase 1 SCO5087 SCBAC28G1.13 actI ORF1 protein protein strco Streptomyces coelicolor A3(2) MPLDAAPVDPASRGPVSAFEPPSSHGADDDDDHRTNASKELFGLKRRVVITGVGVRAPGGNGTRQFWELLTSGRTATRRISFFDPSPYRSQVAAEADFDPVAEGFGPRELDRMDRASQFAVACAREAFAASGLDPDTLDPARVGVSLGSAVAAATSLEREYLLLSDSGRDWEVDAAWLSRHMFDYLVPSVMPAEVAWAVGAEGPVTMVSTGCTSGLDSVGNAVRAIEEGSADVMFAGAADTPITPIVVACFDAIRATTARNDDPEHASRPFDGTRDGFVLAEGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGREMAETIRVALDESRTDATDIDYINAHGSGTRQNDRHETAAYKRALGEHARRTPVSSIKSMVGHSLGAIGSLEIAACVLALEHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLRDAETAGAAA kasa-kasb-1 The actinorhodin ketosynthase-chain length factor 514888 N/A 514889 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false strco Streptomyces coelicolor A3(2) Stoichiometry: 4.0 N/A 514890 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false strch Streptomyces coelicolor Stoichiometry: 4.0 direct interaction direct interaction false false false dimeric, multimeric working 76.700%, free 74.700% 2A MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014za-1 Structural and genomic DNA analysis of the putative TetR transcriptional repressor SCO7518 from Streptomyces coelicolor A3(2) in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined tanaka@sci.hokudai.ac.jp 2014 imex curation Hayashi T., Tanaka Y., Sakai N., Okada U., Yao M., Watanabe N., Tamura T., Tanaka I. FEBS Lett. (0014-5793) Only protein-protein interactions mao-2009b-1 Involvement of SigT and RstA in the differentiation of Streptomyces coelicolor. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Mao XM., Zhou Z., Cheng LY., Hou XP., Guan WJ., Li YQ. FEBS Lett. (0014-5793) 2009 Only protein-protein interactions imex curation mao-2009b-2 Involvement of SigT and RstA in the differentiation of Streptomyces coelicolor. strch Streptomyces coelicolor pull down pull down predetermined predetermined participant predetermined Mao XM., Zhou Z., Cheng LY., Hou XP., Guan WJ., Li YQ. FEBS Lett. (0014-5793) 2009 Only protein-protein interactions imex curation mao-2009b-3 Involvement of SigT and RstA in the differentiation of Streptomyces coelicolor. strch Streptomyces coelicolor anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Mao XM., Zhou Z., Cheng LY., Hou XP., Guan WJ., Li YQ. FEBS Lett. (0014-5793) 2009 Only protein-protein interactions imex curation q9s6u2_strco SCO3891 protein protein strco Streptomyces coelicolor A3(2) MTGHPDVAEIADLAEGLLPTTRTTEVRQHLESCELCADVYASLTEIQGLLGTLPAPAPMPDDVAARIDAALAAEPPLGIADGTRVSRETSTPADRPAGHARPSSTGPGRKDRRRGGRRRIAVLGAVAAAAAIGIGSVVVSSLTEDSSSGNTAREQQTAIADTFSEGRLKDRVTNLVADGSAENGSRTPRSFGMESENGGETAENHVFKQPTVPECIRKGIGRDDAVIATEPGVYKGREALLVVLPDATNDTQVTAYIVETACVDQPAVGKAKILLEHSYARS mint o86856_strch sigT protein protein strch Streptomyces coelicolor MAGGASHDGVSDQELLARHVEGDPDAFGELVRRHRDRLWAVALRTLGDREEAADAVQDALVSAYRAAHTFRGQAAVTTWLHRITVNACLDRARKAASRKTAPVDDTERLEQLLEPHESASAPAERNDLHRQLLEALGTLPADQRAAFVFVDMQGYPVAEAARILDVPAGTIKSRCARGRARLLPLLTHLRPDGSGESRKPGPERNRTHGASVPPAAGPSEAGPGDSTAVKGGGGRA mint rpoc_strco DNA-directed RNA polymerase subunit beta' rpoC Transcriptase subunit beta' RNA polymerase subunit beta' SCD82.27 SCD40A.01 SCO4655 protein protein strco Streptomyces coelicolor A3(2) MLDVNFFDELRIGLATADDIRQWSHGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKVIYFAAYMITFVDEERRTRDLPSLEAHVSVERQQIEQRRDSDLEARAKKLETDLAELEAEGAKADVRRKVREGAEREMKQLRDRAQREIDRLDEVWNRFKNLKVQDLEGDELLYRELRDRFGTYFDGSMGAAALQKRLESFDLDEEAERLREIIRTGKGQKKTRALKRLKVVSAFLQTSNSPKGMVLDCVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSARSVIVVGPQLKLHQCGLPKAMALELFKPFVMKRLVDLNHAQNIKSAKRMVERGRTVVYDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQMAVHLPLSAEAQAEARILMLSSNNILKPADGRPVTMPTQDMVLGLFFLTTDSEGRSPKGEGRAFGSSAEAIMAFDAGDLTLQAKIDIRFPVGTIPPRGFEPPAREEGEPEWQQGDTFTLKTTLGRALFNELLPEDYPFVDYEVGKKQLSEIVNDLAERYPKVIVAATLDNLKAAGFFWATRSGVTVAISDIVVPDAKKEIVKGYEGQDEKVQKQYERGLITKEERTQELIAIWTKATNEVAEAMNDNFPKTNPVSMMVNSGARGNMMQMRQIAGMRGLVSNAKNETIPRPIKASFREGLSVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIIREEDCGTERGLKLPIATRDADGTLRKAEDVETSVYARMLAEDVVIDGKVIAPANVDLGDVLIDALVAHGVEEVKTRSILTCESQVGTCAMCYGRSLATGKLVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRVVELFEARTPKGVAPISEASGRVRIEETEKTKKIVVTPDDGSDETAFPISKRARLLVGEGDHVEVGQKLTVGATNPHDVLRILGQRAVQVHLVGEVQKVYNSQGVSIHDKHIEIIIRQMLRRVTIIESGDAELLPGELVERTKFETENRRVVQEGGHPASGRPQLMGITKASLATESWLSAASFQETTRVLTDAAINAKSDSLIGLKENVIIGKLIPAGTGLSRYRNIRVEPTEEAKAAMYSAVGYDDIDYSPFGTGSGQAVPLEDYDYGPYNQ mint q93j02_strco SCO7518 protein protein strco Streptomyces coelicolor A3(2) MATGHTDPQRRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHIVAVFDEHLGAAADRDEAREAVADLVHELSEDSQRDLVLTQELYTLAARQPAYRELTHEWMRRSRVHLEKHFDPGTARQLDALIEGLTLHRALAREPHGRALTLEAIARITTTDRPAP q93j02 1569708 n/a SCO7518 1569709 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false t1 f1 f2 The asymmetric unit contains four protomers (protomer A, B, C and D; each protomer contains 185 residues) and 149 water molecules [Protein Data Bank (PDB) code: 2dg8], in which protomers A–D and B–C formed homo-dimers q9s6u2-sigt 855269 o86856_strco sigT 855272 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9s6u2_strco RstA 855273 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2C mint sigt-q9s6u2 855269 q9s6u2_strco RstA 855273 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false o86856_strco sigT 855272 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2B mint rpoc-sigt 855270 o86856_strco sigT 855272 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rpoc_strco rpoC 855274 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1 mint q9s6u2-sigt-1 855271 q9s6u2_strco RstA 855273 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false o86856_strco sigT 855272 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2D mint DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ capstick-2011-1 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Capstick DS., Jomaa A., Hanke C., Ortega J., Elliot MA. DIP original experiment: DIP-253952X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Dual amyloid domains promote differential functioning of the chaplin proteins during Streptomyces aerial morphogenesis. Capstick DS., Jomaa A., Hanke C., Ortega J., Elliot MA. Only protein-protein interactions imex curation capstick-2011-2 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Capstick DS., Jomaa A., Hanke C., Ortega J., Elliot MA. DIP original experiment: DIP-253953X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Dual amyloid domains promote differential functioning of the chaplin proteins during Streptomyces aerial morphogenesis. Capstick DS., Jomaa A., Hanke C., Ortega J., Elliot MA. Only protein-protein interactions imex curation sickmier-2005-1 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Sickmier EA., Brekasis D., Paranawithana S., Bonanno JB., Paget MS., Burley SK., Kielkopf CL. DIP original experiment: DIP-132722X Structure (London, England : 1993) 2005 IMEx X-ray structure of a Rex-family repressor/NADH complex insights into the mechanism of redox sensing. Sickmier EA., Brekasis D., Paranawithana S., Bonanno JB., Paget MS., Burley SK., Kielkopf CL. Only protein-protein interactions imex curation sickmier-2005-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sickmier EA., Brekasis D., Paranawithana S., Bonanno JB., Paget MS., Burley SK., Kielkopf CL. DIP original experiment: DIP-132721X Structure (London, England : 1993) 2005 IMEx X-ray structure of a Rex-family repressor/NADH complex insights into the mechanism of redox sensing. Sickmier EA., Brekasis D., Paranawithana S., Bonanno JB., Paget MS., Burley SK., Kielkopf CL. Only protein-protein interactions imex curation rex_strco Redox-sensing transcriptional repressor Rex rex SCE68.18c SCO3320 protein protein strco Streptomyces coelicolor A3(2) MATGRAHRPATRSRGIPEATVARLPLYLRALTALSERSVPTVSSEELAAAAGVNSAKLRKDFSYLGSYGTRGVGYDVEYLVYQISRELGLTQDWPVVIVGIGNLGAALANYGGFASRGFRVAALIDADPGMAGKPVAGIPVQHTDELEKIIQDDGVSIGVIATPAGAAQQVCDRLVAAGVTSILNFAPTVLNVPEGVDVRKVDLSIELQILAFHEQRKAGEEAAADGAAPPVAARKQQRSTGSADQGPDGDVPAVMPA 84B82E3CDB4432A6 chph_strco Chaplin-H chpH SCO1675 protein protein strco Streptomyces coelicolor A3(2) MLKKVVAAAAATGGLVLAGAGMAVADSGAQGAAVHSPGVLSGNVVQVPVHVPVNVCGNTISVIGLLNPAFGNVCINK q9ad92_strco-1 3226807 N/A 3226809 unspecified role unspecified role unspecified role unspecified role Region 38-54 Region 38-54 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 57-72 Region 57-72 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9AD92:p.Val62Ala V62A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9AD92:p.Val62_Leu66delinsAlaAlaAlaAlaAla V62A/I63A/G64A/L65A/L66A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false q9ad92_strco-2 3226808 N/A 3226809 unspecified role unspecified role unspecified role unspecified role Region 38-54 Region 38-54 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 57-72 Region 57-72 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9AD92:p.Val62_Leu66delinsAlaAlaAlaAlaAla V62A/I63A/G64A/L65A/L66A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9AD92:p.Val62Ala V62A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false s_rex-1 3137530 N/A 3137535 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false s_rex-2 3137534 N/A 3137535 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false