UniProt UniProt http://www.uniprot.org graff-2002-2 Interferon regulatory factor 3 is a cellular partner of rotavirus NSP1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Graff J.W., Mitzel D.N., Weisend C.M., Flenniken M.L., Hardy M.E. Rotavirus NSP1 strain B641 has been mapped to UniProt. However, UniProt NSP1 has length of 491 aa, in contrast to 490 aa in publication (fig 3A) . Positions of the mutated cysteines (fig 3D) are identical. mhardy@montana.edu J. Virol. (0022-538X) 2002 Only protein-protein interactions imex curation graff-2002-1 Interferon regulatory factor 3 is a cellular partner of rotavirus NSP1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Graff J.W., Mitzel D.N., Weisend C.M., Flenniken M.L., Hardy M.E. Rotavirus NSP1 strain B641 has been mapped to UniProt. However, UniProt NSP1 has length of 491 aa, in contrast to 490 aa in publication (fig 3A) . Positions of the mutated cysteines (fig 3D) are identical. mhardy@montana.edu MA104 (green monkey) cells cDNA J. Virol. (0022-538X) 2002 Only protein-protein interactions imex curation graff-2002-4 Interferon regulatory factor 3 is a cellular partner of rotavirus NSP1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Graff J.W., Mitzel D.N., Weisend C.M., Flenniken M.L., Hardy M.E. Radiolabelled lysates of MA104 cells infected with rotavirus B641 have been used Rotavirus NSP1 strain B641 has been mapped to UniProt. However, UniProt NSP1 has length of 491 aa, in contrast to 490 aa in publication (fig 3A) . Positions of the mutated cysteines (fig 3D) are identical. mhardy@montana.edu MA104 (green monkey) cells cDNA J. Virol. (0022-538X) 2002 Only protein-protein interactions imex curation irf3_chlae_protein Green monkey Interferon regulatory factor 3 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to human Q14653 entry nsp1_rotb4 Non-structural protein 1 NCVP2 Non-structural RNA-binding protein 53 protein protein rotb4 Rotavirus A (strain Cow/United States/B641/198? G6-P7[5]-Ix-Rx-Cx-Mx-A3-Nx-Tx-Ex-Hx) MATFKDACYHYKKLNKLNSLVLKLGANDEWRPAPVTKYKGWCLDCCQYTNLTYCRGCALYHVCQWCSQYNRCFLDEEPHLLRMRTFKDVVTKEDIEGLLTMYETLFPINEKLVNKFINSVKQRKCRNEYLLEWYNHLLMPITLQALTINLEDNVYYMFGYYDCMEHENQTPFQFVNLLEKYDKLLLDDRNFHRMSHLPVILQQEYALRYFSKSRFLSKGKKRLSRSDFSDNLMEDRHSPTSLMQVVRNCISIHIDDCEWNKACTLIVDARNYISIMNSSYTEHYSVSQRCKLFTKYKFGIVSKLVKPNYIFSSHESCALNVHNCKWCQINNHYKVWEDFRLRKIYNNVMDFIRALVKSNVNVGHCSSQESVYKYVPDLFLICKTEKWSEAVEMLFNYLEPVNVNGTEYVLLDYEVNWEVRGLVMQNMDGKVPRILNMNDTKKILSAMIFDWFDTRYMRETPMTTSTTNQLRTLNKRNELIDEYDLELSDVE q83449_9reov Non-structural protein 1 NCVP2 Non-structural RNA-binding protein 53 protein protein murine rotavirus murine rotavirus MAAFKDACFHYRRITKLNRELLRIGANSTWTPAPPSNIRGWCLECCQLTNLTYCYGCSLHHVCQWCVQYGRCFLDDEPHLLRLRTVKSPITTEKLASIVKMYQLLFPINHSVIKKFVKSTKQHKCRNEFELSWYNQLVLPITLTAAAVHCDDCIYYIFGHYEGKANQSNLPYRFVNCVDEYDRLLLDDVNFDRMAFLPERLQKHYAKRYFIASRTPSAQPVKLTYSDFSVKTLINSGAYARQRIIYRSITDFRWQSHEDPLNDLFLNKDKILAALMTNERRPFLTHNLNLTSLLHELSELVHHAKPCYLHSFHVQPASKVRCRSCSVAFDFHTIDWRIKRIYDDVMYFLRACCRSNVSSGSCSSLEPMDATVKAALLEMFTEDFKHHARFLFHCFNPIEVDNVNYILFNYPLNYDIYNFVMRTLATERLPFTLSYKQFTNILFALVERWYDLSQIERLPLSTTPTNRLIELQEHGDLAEEFDLLLSSSDSDED nsp1-irf3-1 1539789 n/a 1539792 unspecified role unspecified role prey prey n/a 1539793 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8JZ13:p.[Cys54Ala;Cys57Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8JZ13:p.Cys54Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false A construct delta62 (missing the N-terminal 62aa) did not interact physical association physical association false false false 1A and 3 q83449-irf3 1539789 n/a 1539792 unspecified role unspecified role prey prey n/a 1539794 unspecified role unspecified role bait bait physical association physical association false false false 1A nsp1-irf3 1539790 n/a 1539792 unspecified role unspecified role prey prey n/a 1539793 unspecified role unspecified role bait bait physical association physical association false false false no figure irf3-nsp1-2 1539791 n/a 1539792 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1539793 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-ma104 Chlorocebus aethiops MA-104 kidney epithelial cells ma104 Green monkey MA-104 embryonic hidney epithelial cells Originally developed by initial explant culture from an embryonic rhesus monkey kidney cell line, however in 2002 it was discovered that the cells were contaminated with cells of African Green Monkey. The original Rhesus Monkey cells were completely overtaken by the AGMs between passage 7 and 12. http://www.lgcstandards-atcc.org/products/all/CRL-2378.1.aspx?geo_country=gb ATCC® CRL-2378.1 physical association physical association false false false 2