DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ angot-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263877X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263866X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263871X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263882X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263872X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263867X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263884X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-8 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263868X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263883X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263878X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263873X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263874X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263880X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263885X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263869X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-16 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263879X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263881X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263870X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263875X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-20 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263876X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation williams-2014-15 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Williams SJ., Sohn KH., Wan L., Bernoux M., Sarris PF., Segonzac C., Ve T., Ma Y., Saucet SB., Ericsson DJ., Casey LW., Lonhienne T., Winzor DJ., Zhang X., Coerdt A., Parker JE., Dodds PN., Kobe B., Jones JD. DIP original experiment: DIP-266350X Science (New York, N.Y.) 2014 IMEx Structural basis for assembly and function of a heterodimeric plant immune receptor. Williams SJ., Sohn KH., Wan L., Bernoux M., Sarris PF., Segonzac C., Ve T., Ma Y., Saucet SB., Ericsson DJ., Casey LW., Lonhienne T., Winzor DJ., Zhang X., Coerdt A., Parker JE., Dodds PN., Kobe B., Jones JD. Only protein-protein interactions imex curation williams-2014-23 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Williams SJ., Sohn KH., Wan L., Bernoux M., Sarris PF., Segonzac C., Ve T., Ma Y., Saucet SB., Ericsson DJ., Casey LW., Lonhienne T., Winzor DJ., Zhang X., Coerdt A., Parker JE., Dodds PN., Kobe B., Jones JD. DIP original experiment: DIP-266345X Science (New York, N.Y.) 2014 IMEx Structural basis for assembly and function of a heterodimeric plant immune receptor. Williams SJ., Sohn KH., Wan L., Bernoux M., Sarris PF., Segonzac C., Ve T., Ma Y., Saucet SB., Ericsson DJ., Casey LW., Lonhienne T., Winzor DJ., Zhang X., Coerdt A., Parker JE., Dodds PN., Kobe B., Jones JD. Only protein-protein interactions imex curation williams-2014-28 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Williams SJ., Sohn KH., Wan L., Bernoux M., Sarris PF., Segonzac C., Ve T., Ma Y., Saucet SB., Ericsson DJ., Casey LW., Lonhienne T., Winzor DJ., Zhang X., Coerdt A., Parker JE., Dodds PN., Kobe B., Jones JD. DIP original experiment: DIP-266344X Science (New York, N.Y.) 2014 IMEx Structural basis for assembly and function of a heterodimeric plant immune receptor. Williams SJ., Sohn KH., Wan L., Bernoux M., Sarris PF., Segonzac C., Ve T., Ma Y., Saucet SB., Ericsson DJ., Casey LW., Lonhienne T., Winzor DJ., Zhang X., Coerdt A., Parker JE., Dodds PN., Kobe B., Jones JD. Only protein-protein interactions imex curation williams-2014-29 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Williams SJ., Sohn KH., Wan L., Bernoux M., Sarris PF., Segonzac C., Ve T., Ma Y., Saucet SB., Ericsson DJ., Casey LW., Lonhienne T., Winzor DJ., Zhang X., Coerdt A., Parker JE., Dodds PN., Kobe B., Jones JD. DIP original experiment: DIP-266351X Science (New York, N.Y.) 2014 IMEx Structural basis for assembly and function of a heterodimeric plant immune receptor. Williams SJ., Sohn KH., Wan L., Bernoux M., Sarris PF., Segonzac C., Ve T., Ma Y., Saucet SB., Ericsson DJ., Casey LW., Lonhienne T., Winzor DJ., Zhang X., Coerdt A., Parker JE., Dodds PN., Kobe B., Jones JD. Only protein-protein interactions imex curation ask13_arath SKP1-like protein 13 ASK13 At3g60010 F24G16.280 T2O9.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKMVMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANGVPIANVTGVILSKVIEYCKKHVVSDSPTEESKDELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGKKPDEIRALLGIENDFTPEEEEEIRKENQWAFE skp1b_arath SKP1-like protein 1B SKP1-like 2 UFO-binding protein 2 ASK2 UIP2 At5g42190 MJC20.30 SKP1B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE ask14_arath SKP1-like protein 14 At2g03170 ASK14 T18E12.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTEVPLQNVTGKILSIVVEYCKKHVVDEESDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEEIREIFNIENDFTPEEEAAVRKENAWAFE q8xyf7_ralso RSc1801 protein protein ralso ralso Pseudomonas solanacearum MKPVAPVGQSSSAADGVRAPSADAQPGPPAPGPARPARSAAGSSLLQGLAQLLSLCQPRPARPLPQLPPDIFREIARRSDPLTVQRLRVASKPVKAAIEADMRELVIKDRAGLAGVLRAGNYPALEKLTLAGTFTDDDLRGLPASLKALDLSRCRGSITAAGIAHLSRLPLVRLNVRNKRIGAEGARLLANHPTLTSLNVSNGRIGPEGAQALAANTRLTTLNVSGNRIGVAGAKALAANQTLRSLDVSDNRIGDEGARELAACTQLTTLDANRNGIGVDGATALAASRTLTSLAIGGNEIGDAGVLALAANARLTTLNVESTGVGADGVKALAASKTLTWLRLDGNDIGNAGATALAASTSLTTLHLEHSRIGAEGAQALAANTKLTTLDLGYNDIGDAGVRALSANATLVWLSVRRNNLEDASAVSLAAGKTLTTLDISGNGIQDQGAKALAANPTLTTLDVSSNDIKNAGARALAANARLVSLDLRNNRMEESGTRALLANRTLSSLGVSLNCCGQHLIAELMAWANHNGVTMRH ask16_arath SKP1-like protein 16 At2g03190 ASK16 T18E12.14 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLTSSDDESFEVEEAVARKLKVIAHMIDDDCADKAIPLENVTGNILALVIEYCKKHVLDDVDDSDDSTEATSENVNEEAKNELRTWDAEFMKEFDMETVMKLILAVNYLNVQDLLGLTCQTVADHMKDMSPEEVRELFNIENDYTPEEEDAIRKENAWAFEDLK ask4_arath SKP1-like protein 4 T20H2.8 At1g20140 ASK4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLTCKAVADQMRGKTPEQMRAHFNIKNDYTPEEEAEVRNENKWAFE ask11_arath SKP1-like protein 11 ASK11 At4g34210 F10M10.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKHHVDEANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE q8xre0_ralso RSp0914 protein protein ralso ralso Pseudomonas solanacearum MGNQFSINRNRPANAGEAHASSTEAKPAPDAASPSRQVRVATAPSILEGLRKLRLPFNFGARVPPLPEETWAEIARRVDTKTLHRMRAVSKTLKAAADTEIRQLTVNTVEALQAAKRYACLETLKMDGYFGDADLEGLPASLRELDLFSTRYVSAKGLAHLSKLPLVRLKVRANGIHAEAARALAASTTLTALDIRGNGIGDAGAQALAANTSITSLDASFNDIGVAGARALAANTTLTSLDLGFNAIGDEGLQALATNTSLTSLTVGSCEIGDAGAAALANNTALTSVDLTCNHIGEEGAEGLAANTVLTSLDLTRNSISDRGAAALAGNTTLTSLCVNFNDIYGRGARWLAENTTLTTLDISYNPIGDWGALGLADNMTLRSLSVVAGRIGVEGARALAGNTTLTTLDISVNAIGNEGAQALAANATLTTLSLRSCELRAAAAEAFKANTTLASLDIGENRIEAAGAQALADNTALTTLRVTGNQIGMAGAQALAANRSLTKLNISQNDIRSAGAQALAANTSLTSLDVSSASIGAAGAQALAANTSITWLNINDNHIGDAGAQALAAHPALTSLYACDNFIGTAGVQALAANTRLTSLSIWGNRIGDAGVKALAANTTLTKLTIGKRVDKQLGEQIGDLAWQELMASVDRSGMTFHSL skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE q8xzn9_ralso ripG RSc1356 protein protein ralso ralso Pseudomonas solanacearum MVSRIPTGNRGQGNGIEQSASSHATEATPWLGVNLPYGHWLPSSARSVVSRASSLLGGLANFRWGGRPASARPAPNIRSAAIAPAQQTLPPELWQQIATLAGARPRRAMREVSLELRNASRAVVTHLTISDPAMFRQLSLYPALKSVRFKGELTLEALKALPPELEHLEIGRCTGSAISAEGLAHLASMPLKSLNLNGIEIGVEGARTLAASKSLVSLSLIGCGIGDRAAQALVASRSIQCLDLSVNRIGRDGAQALAGAPLVSLNLHNNEIGNEGARVLATSRTLTSLDVSNNGVGNAGAEAFAGNTVLKQLSLAGGMISGDGAQALADNKSLTDLDLSNNRLGDAGAQALADSESFVSLKLGGNEIGADGAEALARNVVLQSLNLSYNPIGFWGVNALGRAKLRKLDLCACAIDSDGASALARNTSLASLYLGSNRIGDDGARALAKNSTLTLLNLSGNNIHAVGAQALASNDSLITLDLSRNGIGDDGTAALACHPRLTSLNLSRNQIGSTGAQQLAKSATLAELDLSENRIGPEGAEALARSTVLTTLNVSYNAIGEAGARALAESVSLTSLDARRNGIGEDGAKVLEANTRITGTPQNPNFLAEDVPRPDVRWRD q8xzn8_ralso RSc1357 protein protein ralso ralso Pseudomonas solanacearum MMFKRIDSSVFSPYVRPEPSAPPLPEQGAPSGRAANSASHPYIRPEPSAPLLPEGGFPHVPDQAGEQRAYSPSRSSAGVSSSPLGGLAAMRLDSGSAGTAPMLRSRLPPAPSAPSGVPQVRNIEEMPAGVLQHVASFLDPRSRRALSQVSTTMNDAARSSQTHMQAWNKAMLGQLHRYPNLQSLRLRGDITLDELKALPKTLRHIDLGECDPGCGAKSHAAIEYLATLPLESLNVKGAAIGDRGAALLAGNRSLKTLNVADGGISEVGARKLADHASLESLDMTGNQIDARGAQHLATSESIQTLRLCCCGVTDPGIQALAGNRQLKSLDVSGNHINEDALRALAANPSLTTLDVSCNRQTPVGEPQSVEQGVSMALALAEGLVGRETPLASLKADGNAFVDFAVEMLAFPTIRTASLSLKSNFIGPEGAQKLAENPALKSLDLTRNKIGDAGAEALSHSRSLKTLSVLNCDVKDPGAQALARNPTLTTLDLGNLISEKQNPAARQQEQDEFDTTANEITENGTRALAQSPSLISLSVQGNLCEDAGVLPLARSPRLTSLNVAYTNMTLESARELASNPVLTSLNVRWNYEHLGTAGVLELAKSQSLTFLDARDTCMGEAGALALEANTRIKGTPDDPNFIRDSYRG rps4_arath Disease resistance protein RPS4 Probable NAD(+) hydrolase RPS4 RPS4 Resistance to Pseudomonas syringae 4 TIR-NBS-LRR class disease resistance protein K9E15.1 At5g45250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METSSISTVEDKPPQHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKAVKTALTGIPPEGSHNAVVGALGNSNAGTSSGDKKHETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNHPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVESLLASSDLGSAEAMSAVKSLTDKFLINTCDGRVEMHDLLYKFSREVDLKASNQDGSRQRRLWLHQHIIKGGIINVLQNKMKAANVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLKLPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSEMEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAKEEITSYAQRKCQLLSYARKRYNGGLVSESLFSTCFPGCEVPSWFCHETVGSELEVKLLPHWHDKKLAGIALCAVVSCLDPQDQVSRLSVTCTFKVKDEDKSWVAYTCPVGSWTRHGGGKDKIELDHVFIGYTSCPHTIKCHEEGNSDECNPTEASLKFTVTGGTSENGKYKVLKCGLSLVYAKDKDKNSALETKYDMLIGKSFQETSEGVDGRVKKTKGKYVMPVEKNFQETTEGVDGRVNKKKKTRMDNGRPKKKQRSGRDDNQTRMQVELQEGNINSVIMHTVKNF wrk52_arath Disease resistance protein RRS1 RRS1 Disease resistance protein RCH2 Disease resistance protein SLH1 Probable WRKY transcription factor 52 Protein RPS4-homolog Protein SENSITIVE TO LOW HUMIDITY 1 RCH2 RRS1-S RSH4 Resistance to Colletotrichum higginsianum 2 protein Resistance to Ralstonia solanacearum 1 protein SLH1 WRKY DNA-binding protein 52 WRKY52 K9E15.2/K9E15.3 At5g45260/At5g45270 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTNCEKDEEFVCISCVEEVRYSFVSHLSEALRRKGINNVVVDVDIDDLLFKESQAKIEKAGVSVMVLPGNCDPSEVWLDKFAKVLECQRNNKDQAVVSVLYGDSLLRDQWLSELDFRGLSRIHQSRKECSDSILVEEIVRDVYETHFYVGRIGIYSKLLEIENMVNKQPIGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLSSLRDRLNSKRVLVVLDDVRNALVGESFLEGFDWLGPGSLIIITSRDKQVFCLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLQELSVRVINYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKIVDAFKSTYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPHVEIDVLVDKCLVTISENRVWLHKLTQDIGREIINGETVQIERRRRLWEPWSIKYLLEYNEHKANGEPKTTFKRAQGSEEIEGLFLDTSNLRFDLQPSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSHHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEELERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHGSDSEKLPMHYKFNNFFDLSQQVVNDFLLKTLTYVKHIPRGYTQELINKAPTFSFSAPSHTNQNATFDLQSGSSVMTRLNHSWRNTLVGFGMLVEVAFPEDYCDATDVGISCVCRWSNKEGRSCRIERKFHCWAPWQVVPKVRKDHTFVFSDVNMRPSTGEGNDPDIWAGLVVFEFFPINQQTKCLNDRFTVRRCGVRVINVATGNTSLENIALVLSLDPVEVSGYEVLRVSYDDLQEMDKVLFLYIASLFNDEDVDFVAPLIAGIDLDVSSGLKVLADVSLISVSSNGEIVMHSLQRQMGKEILHGQSMLLSDCESSMTENLSDVPKKKKKHSESRVKKVVSIPAIDEGDLWTWRKYGQKDILGSRFPRGYYRCAYKFTHGCKATKQVQRSETDSNMLAITYLSEHNHPRPTKRKALADSTRSTSSSIC q8y125_ralso popP2 RSc0868 protein protein ralso ralso Pseudomonas solanacearum MKVSSANAGVPASSADNTSARPSQTNADTTPLGRRRRAPDDAPGSPPARRQRQDSPEDSAQTMFRRAGMTSLPPSPATSEHVPLLDNRPTLERMGVDHPLPGRTWYETGHTTASLADRTSTASAAQVASSSRSAGPATAARPQPTRTSAGQQATVGRLRTQVTGFLSGALGKLQALSAQNMDPELAQFRVLDVDRAIMPLLIVAENARNPGLNLVPLHMDMAEDEEVRTQPPMAGSRHIAEFVASARPGRYRAVIDDGSHTRAADIRKDASGTSVIVVDPLRKEKDESAYVDYADNVNMEFGEHAKCAFIPVDIQKSFFDCRILSLSLALKMHDKDDAFAAFHETLRNGGDPSHHVSRAQQTEELGATLVLDGAPLVDARMMKHGQAASSVSRYLGNHPEQSTVPVNKRNETLGERTTRHLVKRKVRNRADSEGRVTSGETKEITFSNSVEQKRIALLNRAASYVNSAPPPVVMRMAKLLQDSLLDTN q8xre0_ralso-ask11-1 3148247 N/A 3148267 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-skp1a-1 3148248 N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148270 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xzn8_ralso-skp1a-1 3148249 N/A 3148271 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-ask13-1 3148250 N/A 3148270 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148272 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-skp1b-1 3148251 N/A 3148273 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-skp1a-2 3148252 N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148270 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-ask14-1 3148253 N/A 3148274 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-skp1b-1 3148254 N/A 3148273 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3148270 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false q8xzn8_ralso-ask13-1 3148255 N/A 3148271 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148272 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xyf7_ralso-ask11-1 3148256 N/A 3148275 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148267 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xyf7_ralso-skp1b-1 3148257 N/A 3148275 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148273 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-skp1b-2 3148258 N/A 3148270 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148273 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-ask13-1 3148259 N/A 3148272 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-ask16-1 3148260 N/A 3148276 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-skp1a-1 3148261 N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xzn8_ralso-ask11-1 3148262 N/A 3148271 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148267 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xyf7_ralso-ask13-1 3148263 N/A 3148275 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148272 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xyf7_ralso-skp1a-1 3148264 N/A 3148275 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xzn8_ralso-skp1b-1 3148265 N/A 3148271 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148273 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-ask4-1 3148266 N/A 3148277 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rrs1-popp2-1 3265267 N/A 3265291 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3265289 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3265288 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana association association false false false popp2-rrs1-1 3265275 N/A 3265291 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3265288 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false popp2-rps4-1 3265280 N/A 3265291 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3265289 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3265288 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana association association false false false rrs1-popp2-2 3265281 N/A 3265291 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3265288 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false