MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint suh-2010-2 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation suh-2010-3 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation suh-2010-1 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation suh-2010-4 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation anonymous-2014i-1 allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined ltong@columbia.edu 2014 imex curation Srinivasan B., Forouhar F., Shukla A., Sampangi C., Kulkarni S., Abashidze M., Seetharaman J., Lew S., Mao L., Acton T.B., Xiao R., Everett J.K., Montelione G.T., Tong L., Balaram H. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014i-2 allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined ltong@columbia.edu 2014 imex curation Srinivasan B., Forouhar F., Shukla A., Sampangi C., Kulkarni S., Abashidze M., Seetharaman J., Lew S., Mao L., Acton T.B., Xiao R., Everett J.K., Montelione G.T., Tong L., Balaram H. FEBS J. (1742-464X) Only protein-protein interactions mihai-2013-1 Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mihai Gazdag E., Streller A., Haneburger I., Hilbi H., Vetter I.R., Goody R.S., Itzen A. aymelt.itzen@tum.de EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation yu-2018-3 in vitro In vitro protein array protein array tag fluorescence tag visualisation by fluorescence tag fluorescence Yu X., Noll RR., Romero Dueñas BP., Allgood SC., Barker K., Caplan JL., Machner MP., LaBaer J., Qiu J., Neunuebel MR. Top candidates were selected based on two criteria: a Z-score >= 3 and signal-to-noise ratio >= 1.5. This approach employs NAPPA displaying thousands of human proteins originating from printed expression plasmids carrying cDNAs on aminosilane-coated slides. Gene expression is accomplished via in vitro transcription/translation (IVTT) and the newly synthesized proteins are captured in situ by a co-spotted anti-tag antibody. The Legionella query protein fused to a C-terminal HaloTag (Promega) was detected using Alexa Fluor 660-labeled HaloTag ligand yuxiaobo@mail.ncpsb.org BMC microbiology 2018 Only protein-protein interactions imex curation imex curation yu-2018-4 in vitro In vitro pull down pull down tag fluorescence tag visualisation by fluorescence tag fluorescence Yu X., Noll RR., Romero Dueñas BP., Allgood SC., Barker K., Caplan JL., Machner MP., LaBaer J., Qiu J., Neunuebel MR. we performed an in vitro bead-based pull-down assay. Bait GST-tagged candidate proteins produced in vitro were isolated from lysate using anti-GST antibody-coated magnetic beads, and then incubated with HeLa cell lysate containing IVTT-produced query protein, AnkX-HaloTag or HaloTag alone yuxiaobo@mail.ncpsb.org BMC microbiology 2018 Only protein-protein interactions imex curation imex curation yu-2018-7 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging tag visualisation tag visualisation Yu X., Noll RR., Romero Dueñas BP., Allgood SC., Barker K., Caplan JL., Machner MP., LaBaer J., Qiu J., Neunuebel MR. yuxiaobo@mail.ncpsb.org BMC microbiology 2018 Only protein-protein interactions imex curation imex curation yu-2018-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Yu X., Noll RR., Romero Dueñas BP., Allgood SC., Barker K., Caplan JL., Machner MP., LaBaer J., Qiu J., Neunuebel MR. yuxiaobo@mail.ncpsb.org BMC microbiology 2018 Only protein-protein interactions imex curation imex curation yu-2018-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yu X., Noll RR., Romero Dueñas BP., Allgood SC., Barker K., Caplan JL., Machner MP., LaBaer J., Qiu J., Neunuebel MR. yuxiaobo@mail.ncpsb.org BMC microbiology 2018 Only protein-protein interactions imex curation imex curation li-2013h-4 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation li-2013h-1 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation li-2013h-2 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation li-2013h-3 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation li-2013h-5 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation lucas-2014-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lucas M., Gaspar AH., Pallara C., Rojas AL., Fernández-Recio J., Machner MP., Hierro A. machnerm@mail.nih.gov ahierro@cicbiogune.es Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation lucas-2014-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lucas M., Gaspar AH., Pallara C., Rojas AL., Fernández-Recio J., Machner MP., Hierro A. machnerm@mail.nih.gov ahierro@cicbiogune.es Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation lucas-2014-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lucas M., Gaspar AH., Pallara C., Rojas AL., Fernández-Recio J., Machner MP., Hierro A. machnerm@mail.nih.gov ahierro@cicbiogune.es Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation lucas-2014-5 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Lucas M., Gaspar AH., Pallara C., Rojas AL., Fernández-Recio J., Machner MP., Hierro A. machnerm@mail.nih.gov ahierro@cicbiogune.es Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation lucas-2014-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lucas M., Gaspar AH., Pallara C., Rojas AL., Fernández-Recio J., Machner MP., Hierro A. machnerm@mail.nih.gov ahierro@cicbiogune.es Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation lucas-2014-8 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Lucas M., Gaspar AH., Pallara C., Rojas AL., Fernández-Recio J., Machner MP., Hierro A. machnerm@mail.nih.gov ahierro@cicbiogune.es Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation michard-2015-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Michard C., Sperandio D., Baïlo N., Pizarro-Cerdá J., LeClaire L., Chadeau-Argaud E., Pombo-Grégoire I., Hervet E., Vianney A., Gilbert C., Faure M., Cossart P., Doublet P. weiguohu@fudan.edu.cn mBio 2015 Only protein-protein interactions imex curation imex curation michard-2015-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Michard C., Sperandio D., Baïlo N., Pizarro-Cerdá J., LeClaire L., Chadeau-Argaud E., Pombo-Grégoire I., Hervet E., Vianney A., Gilbert C., Faure M., Cossart P., Doublet P. weiguohu@fudan.edu.cn mBio 2015 Only protein-protein interactions imex curation imex curation michard-2015-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Michard C., Sperandio D., Baïlo N., Pizarro-Cerdá J., LeClaire L., Chadeau-Argaud E., Pombo-Grégoire I., Hervet E., Vianney A., Gilbert C., Faure M., Cossart P., Doublet P. weiguohu@fudan.edu.cn mBio 2015 Only protein-protein interactions imex curation imex curation q5zwz3_legph lpg0940 protein protein legph Legionella pneumophila subsp. pneumophila MAKDNKSHQVKTSEGSLESVKTKEKEPVLEKMRVEDSKKEDKLSMPTTKKESQPNEPVKPFKTSFEKWIESSLLDPQAKEDRGSTINLGREGLKNASQVKKFLLSPAGKDVIAELGAQMALQRNINLQNQQDRMEHELFKRRLMAALFLWYLSKKSHAAEKVKEIIREYNEKAIKNAEKASKPSQQSTSSTSQADKEIQKMLDEYEQAIKRAQENIKKGEELEKKLDKLERQGKDLEDKYKTYEENLEGFEKLLTDSEELSLSEINEKMEAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAHLAINKDQEVVEHEGQFYLLQKGQWDAIKNNPAALEKAQKDYSQSKHDLATIKMEALIHKLSLEMEKQLETINNLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVHRKEKSFFNEKGEEVTSLNDAHYVIGKDQQLFNLGGKFYPIHKEQKILEKDGKFYLLKQGEDWESIKDSPEKQKKAEHDFHKLQYETPMTVKKLVHHNKGLETTIHKERVEETKQQLEDNGKEKIEIANNISKLQSTVGVALNQLNQPTLDTESPVLTPSGGSTTSSPKPTPSLASVTTFFKTKIDEMKKNENVKVTFDDLLALSIKIADPKARTYFTGELLKEVPRSGAIPFQTMQRMLQTLEQYGVDTTKPSVTSIRSKTDEVLEQRFNPTPSLSPFKTS rab35_human Ras-related protein Rab-35 Ras-related protein Rab-1C GTP-binding protein RAY RAB35 RAB1C RAY protein protein human Homo sapiens Human MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC birc8_human Baculoviral IAP repeat-containing protein 8 BIRC8 ILP2 Inhibitor of apoptosis-like protein 2 Testis-specific inhibitor of apoptosis protein protein human Homo sapiens Human MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS vpp3_human V-type proton ATPase 116 kDa subunit a3 TCIRG1 ATP6N1C ATP6V0A3 Osteoclastic proton pump 116 kDa subunit T-cell immune regulator 1 T-cell immune response cDNA7 protein Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3 protein protein human Homo sapiens Human MGSMFRSEEVALVQLFLPTAAAYTCVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFHCHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMKAVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPTLIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAMVLAENRPAVKAAQNEIWQTFFRGRYLLLLMGLFSIYTGFIYNECFSRATSIFPSGWSVAAMANQSGWSDAFLAQHTMLTLDPNVTGVFLGPYPFGIDPIWSLAANHLSFLNSFKMKMSVILGVVHMAFGVVLGVFNHVHFGQRHRLLLETLPELTFLLGLFGYLVFLVIYKWLCVWAARAASAPSILIHFINMFLFSHSPSNRLLYPRQEVVQATLVVLALAMVPILLLGTPLHLLHRHRRRLRRRPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTIEFCLGCVSNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGLGREVGVAAVVLVPIFAAFAVMTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTFAATDD nemo_human NF-kappa-B essential modulator IKBKG FIP3 NEMO NF-kappa-B essential modifier Inhibitor of nuclear factor kappa-B kinase subunit gamma IkB kinase-associated protein 1 FIP-3 protein protein human Homo sapiens Human MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE psb5_human Proteasome subunit beta type-5 PSMB5 LMPX Proteasome epsilon chain Macropain epsilon chain Multicatalytic endopeptidase complex epsilon chain Proteasome subunit X Proteasome chain 6 Proteasome subunit MB1 MB1 X protein protein human Homo sapiens Human MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS pak5_human Serine/threonine-protein kinase PAK 5 PAK5 KIAA1264 PAK7 p21-activated kinase 5 p21-activated kinase 7 protein protein human Homo sapiens Human MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQSQSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSSDQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH rn216_human E3 ubiquitin-protein ligase RNF216 TRIAD3 UBCE7IP1 RING finger protein 216 Ubiquitin-conjugating enzyme 7-interacting protein 1 Zinc finger protein inhibiting NF-kappa-B Triad domain-containing protein 3 RNF216 ZIN RING-type E3 ubiquitin transferase RNF216 protein protein human Homo sapiens Human MEEGNNNEEVIHLNNFHCHRGQEWINLRDGPITISDSSDEERIPMLVTPAPQQHEEEDLDDDVILTEDDSEDDYGEFLDLGPPGISEFTKPSGQTEREPKPGPSHNQAANDIVNPRSEQKVIILEEGSLLYTESDPLETQNQSSEDSETELLSNLGESAALADDQAIEEDCWLDHPYFQSLNQQPREITNQVVPQERQPEAELGRLLFQHEFPGPAFPRPEPQQGGISGPSSPQPAHPLGEFEDQQLASDDEEPGPAFPMQESQEPNLENIWGQEAAEVDQELVELLVKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDETKLPKIDFFDYSKLTPLDQRCFIQAADLLMADFKVLSSQDIKWALHELKGHYAITRKALSDAIKKWQELSPETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMCYLCRVSINGYDHFCQHPRSPGAPCQECSRCSLWTDPTEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPPLEKPVEKVQRVEALPRPVPQNLPQPQMPPYAFAHPPFPLPPVRPVFNNFPLNMGPIPAPYVPPLPNVRVNYDFGPIHMPLEHNLPMHFGPQPRHRF naa60_human N-alpha-acetyltransferase 60 NAA60 HAT4 Histone acetyltransferase type B protein 4 N-acetyltransferase 15 NAT15 UNQ2771/PRO7155 N-alpha-acetyltransferase F protein protein human Homo sapiens Human MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRTM milk1_human MICAL-like protein 1 MICALL1 KIAA1668 MIRAB13 Molecule interacting with Rab13 protein protein human Homo sapiens Human MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDVAQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVPKPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLESKPYNPFEEEEEDKEEEAPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLALHASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSLASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSCKENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS kapcb_human cAMP-dependent protein kinase catalytic subunit beta PRKACB protein protein human Homo sapiens Human MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF dreb_human Drebrin DBN1 Developmentally-regulated brain protein D0S117E protein protein human Homo sapiens Human MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEGFEGGD zch10_human Zinc finger CCHC domain-containing protein 10 ZCCHC10 protein protein human Homo sapiens Human MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKAKKKRSKSVTSSSSSSSDSSASDSSSESEETSTSSSSEDSDTDESSSSSSSSASSTTSSSSSDSDSDSSSSSSSSTSTDSSSDDEPPKKKKKK ankx_legph Phosphocholine transferase AnkX ankX legA8 lpg0695 Ankyrin repeat-containing protein X protein protein legph Legionella pneumophila subsp. pneumophila MVKIMPNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLHPFRDANGRTFVNNLLNILLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFSDLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGTPELISALTTTEVIQINEPDNSGSSAITLAYKNHKLKIFDELLNSGADISDELLDAIWARKDKETLGKIIAKNEKILLNKEAFRIAISLGSVSLVKKFLRAGVDIDIPLTKDKATPLMLSINSGNPKLVSYLLKKGANTRLTDTSGNSVLHYVFYSKAENREALANIITEKDKKLINQPNANGNPPLYNAVVVNDLKMATILLEMGARVDFEDRLGNNILHSAMRRCDLPIILDIVKKDSTLLHKRNSERRNPFHQALHEMHTFPSSKETEEIHFMNLSDLLLKEGVDLNKKDIKGKTILDIALSKQYFHLCVKLMKAGAHTNISSPSKFLKNSDANSILERPFKFKNDLKKELDNNPLIAMAQINDLYVQIKNNRIRTPTGYAPKEGVSFFKGKSNDAKAHDEVLSVLKELYDSKLTEMLGNLPGEGLEEIKRSQKFFDGELKLLIKNQDISRKVDKKSIQEAVGTSLKLKW gpbp1_human Vasculin GPBP1 GPBP SSH6 GC-rich promoter-binding protein 1 Vascular wall-linked protein protein protein human Homo sapiens Human MAQHDFAPAWLNFPTPPSSTKSSLNFEKHSENFAWTENRYDVNRRRHNSSDGFDSAIGRPNGGNFGRKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIPDNETGRKEDKRERKQFEAEDFPSLNPEYEREPNHNKSLAAGVWEYPPNPKSRAPRMLVIKKGNTKDLQLSGFPVVGNLPSQPVKNGTGPSVYKGLVPKPAAPPTKPTQWKSQTKENKVGTSFPHESTFGVGNFNAFKSTAKNFSPSTNSVKECNRSNSSSPVDKLNQQPRLTKLTRMRTDKKSEFLKALKRDRVEEEHEDESRAGSEKDDDSFNLHNSNSTHQERDINRNFDENEIPQENGNASVISQQIIRSSTFPQTDVLSSSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISEQLQKNGLRKNGILKNGLICDFKFGPWKNSTFKPTTENDDTETSSSDTSDDDDV cp4f8_human Cytochrome P450 4F8 CYPIVF8 CYP4F8 protein protein human Homo sapiens Human MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG pkha4_human Pleckstrin homology domain-containing family A member 4 Phosphoinositol 3-phosphate-binding protein 1 PLEKHA4 PEPP1 protein protein human Homo sapiens Human MEGSRPRSSLSLASSASTISSLSSLSPKKPTRAVNKIHAFGKRGNALRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASRAEGDDYGQPRSPARPQPGEGPGGPGGPPEVSRGEEGRISESPEVTRLSRGRGRPRLLTPSPTTDLHSGLQMRRARSPDLFTPLSRPPSPLSLPRPRSAPARRPPAPSGDTAPPARPHTPLSRIDVRPPLDWGPQRQTLSRPPTPRRGPPSEAGGGKPPRSPQHWSQEPRTQAHSGSPTYLQLPPRPPGTRASMVLLPGPPLESTFHQSLETDTLLTKLCGQDRLLRRLQEEIDQKQEEKEQLEAALELTRQQLGQATREAGAPGRAWGRQRLLQDRLVSVRATLCHLTQERERVWDTYSGLEQELGTLRETLEYLLHLGSPQDRVSAQQQLWMVEDTLAGLGGPQKPPPHTEPDSPSPVLQGEESSERESLPESLELSSPRSPETDWGRPPGGDKDLASPHLGLGSPRVSRASSPEGRHLPSPQLGTKAPVARPRMSAQEQLERMRRNQECGRPFPRPTSPRLLTLGRTLSPARRQPDVEQRPVVGHSGAQKWLRSSGSWSSPRNTTPYLPTSEGHRERVLSLSQALATEASQWHRMMTGGNLDSQGDPLPGVPLPPSDPTRQETPPPRSPPVANSGSTGFSRRGSGRGGGPTPWGPAWDAGIAPPVLPQDEGAWPLRVTLLQSSF pkhn1_human Pleckstrin homology domain-containing family N member 1 PLEKHN1 CLPABP Cardiolipin and phosphatidic acid-binding protein protein protein human Homo sapiens Human MGNSHCVPQAPRRLRASFSRKPSLKGNREDSARMSAGLPGPEAARSGDAAANKLFHYIPGTDILDLENQRENLEQPFLSVFKKGRRRVPVRNLGKVVHYAKVQLRFQHSQDVSDCYLELFPAHLYFQAHGSEGLTFQGLLPLTELSVCPLEGSREHAFQITGPLPAPLLVLCPSRAELDRWLYHLEKQTALLGGPRRCHSAPPQRRLTRLRTASGHEPGGSAVCASRVKLQHLPAQEQWDRLLVLYPTSLAIFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVVCASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQVMGSGRGSLSSGGQTSWDSGCLAPPSTRTSHSLPESSVPSTVGCSSQHTPDQANSDRASIGRRRTELRRSGSSRSPGSKARAEGRGPVTPLHLDLTQLHRLSLESSPDAPDHTSETSHSPLYADPYTPPATSHRRVTDVRGLEEFLSAMQSARGPTPSSPLPSVPVSVPASDPRSCSSGPAGPYLLSKKGALQSRAAQRHRGSAKDGGPQPPDAPQLVSSAREGSPEPWLPLTDGRSPRRSRDPGYDHLWDETLSSSHQKCPQLGGPEASGGLVQWI cbx3_human Chromobox protein homolog 3 CBX3 Heterochromatin protein 1 homolog gamma Modifier 2 protein HECH protein protein human Homo sapiens Human MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ cbx5_mouse Chromobox protein homolog 5 Cbx5 Hp1a Heterochromatin protein 1 homolog alpha protein protein mouse Mus musculus Mouse MGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESAKS a0a0h3lym0_borbr BB4970 protein protein borbr Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) Alcaligenes bronchisepticus MTEIIKPWHSVRRSRLHGNGVFATRKIPAGTRIIEYGGKRISAAEADRRHPTNPDDPFHTFFFSLSSGRVIDGGDEGNDARWINHSCDPNCEAQEGRHGKRVYIVALRDIARGEELFYDYGLVLDGRITRKLKEGYRCLCGTTPCRGTMLALPEKKKTKARSAEKA q2stb6_burta BTH_I3341 protein protein burta Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) MRRSARRRSTGVRSRASTRRCSATYRSASVERRARRMEAGRRRAARMPISSAPIRLPMRPIFRQLRGFRATSRIARPFDVERSNPERVGFGDSNPSRRAACQPYTARRAKPRGRHAMRGAIVSVSSRHQRIRSMSSRRIVVRRSGVHGKGVFAAVPIKAGERVVEYKGERISWKEALRRHPHDPNDPNHTFYFALEEGGVIDGKIDGNSARWINHSCAPNCEAEEVDGRVYIHALRDIGEQEELFYDYGLVIDARLTKKLKREYACHCGAATCRGTLLATSEDDEGKKKKKAKKGGKDKKKKK cbx5_human Chromobox protein homolog 5 CBX5 Heterochromatin protein 1 homolog alpha Antigen p25 HP1A protein protein human Homo sapiens Human MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL q5zus4_legph legAS4 lpg1718 protein protein legph Legionella pneumophila subsp. pneumophila MIILYDFLQESSVMPRSKNDSKLKKKSALQSKFKEQQLNHGSKEHKSKFKFSQRKAKKKGPGMTHLPGNIYTLFTPVNGPKSKDEWIDTSKIMLDLHIDNMSSSDYIPSAIDRTDLVMVQSVHLLRKTGGRGLFAREDIPKGTCIGIYTGEVYSEQEFEQYLKEHVGSDKSYAMYVGGRVIDAARKGNLTRYINFSDSQDNAEFVETTLNRKKVAKVITTKNIKAGQQLLINYNTYEEQASRYYYFLNPGDGWLSAQEFYQTYQSQYRLEQMPYNLEGFDLKAGDRVLMTQIGRIILANYSLAKEQELNASDIDLPFLKVGSDEKILDFDEADTFTPLMAACYLGQVENVKWLIEHGANIDQQQSHSGHCPLSLTLKGYSLAKDTQKYIDIIQLLIKNQVNLLVHDRSDKTFLHNAALVLNNLDFQSVVKFLIGQNPIDINEYFTYIDENDFDIVMHCYNNKLFDKALVLLAFYPDYFKRNYMSDNEGHNQFNINAFRKAIKDFNSNERSILLMQLRESGLHLPEDLLEQLGIMDSSITLESKFF q5zzb6_legph lpg0095 protein protein legph Legionella pneumophila subsp. pneumophila MDTHKVFVNRIINMRKIKLIGLDMDHTLIRYNSKNFESLVYDLVKERLAESFHYPEEIKKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSDQKKIYRSIYVDLGDPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYCVDKVHSDGTLKNIIIKNLKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDYALSPFLDKGEHWQGLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQGGNAKKFTEDLGVGGDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPIEKKIGEAMAIKKELEQKYVDLCTRSIDESSQQYDQEIHDLQLQISTVDLQISRLLQEQNSFYNPKWERVFRAGAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDIDI rabe1_human Rab GTPase-binding effector protein 1 Rabaptin-5 Rabaptin-5alpha Rabaptin-4 Renal carcinoma antigen NY-REN-17 RABEP1 RABPT5 RABPT5A RAB5EP protein protein human Homo sapiens Human MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQNAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMKETVRDYEHQFHLRLEQERTQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASKVKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVCALTQEESSAQLSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET rb22a_human Ras-related protein Rab-22A RAB22A RAB22 protein protein human Homo sapiens Human MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC rab5c_human Ras-related protein Rab-5C RABL RAB5C RAB5L L1880 protein protein human Homo sapiens Human MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN q5zrp9_legph vipD lpg2831 protein protein legph Legionella pneumophila subsp. pneumophila MKLAEIMTKSRKLKRNLLEISKTEAGQYSVSAPEHKGLVLSGGGAKGISYLGMIQALQERGKIKNLTHVSGASAGAMTASILAVGMDIKDIKKLIEGLDITKLLDNSGVGFRARGDRFRNILDVIYMMQMKKHLESVQQPIPPEQQMNYGILKQKIALYEDKLSRAGIVINNVDDIINLTKSVKDLEKLDKALNSIPTELKGAKGEQLENPRLTLGDLGRLRELLPEENKHLIKNLSVVVTNQTKHELERYSEDTTPQQSIAQVVQWSGAHPVLFVPGRNAKGEYIADGGILDNMPEIEGLDREEVLCVKAEAGTAFEDRVNKAKQSAMEAISWFKARMDSLVEATIGGKWLHATSSVLNREKVYYNIDNMIYINTGEVTTTNTSPTPEQRARAVKNGYDQTMQLLDSHKQTFDHPLMAILYIGHDKLKDALIDEKSEKEIFEASAHAQAILHLQEQIVKEMNDGDYSSVQNYLDQIEDILTVDAKMDDIQKEKAFALCIKQVNFLSEGKLETYLNKVEAEAKAAAEPSWATKILNLLWAPIEWVVSLFKGPAQDFKVEVQPEPVKVSTSENQETVSNQKDINPAVEYRKIIAEVRREHTDPSPSLQEKERVGLSTTFGGH eea1_human Early endosome antigen 1 EEA1 ZFYVE2 Endosome-associated protein p162 Zinc finger FYVE domain-containing protein 2 protein protein human Homo sapiens Human MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTRLTEELNKEATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNELTQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSLHRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKIQHEELNNRIQTTVTELQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQMENTLKEQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG rbns5_human Rabenosyn-5 RBSN 110 kDa protein FYVE finger-containing Rab5 effector protein rabenosyn-5 RAB effector RBSN ZFYVE20 Zinc finger FYVE domain-containing protein 20 protein protein human Homo sapiens Human MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKDRLLKREGDDRAESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVEVNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCRLCGSIMCKKCMELISLPLANKLTSASKESLSTHTSPSQSPNSVHGSRRGSISSMSSVSSVLDEKDDDRIRCCTHCKDTLLKREQQIDEKEHTPDIVKLYEKLRLCMEKVDQKAPEYIRMAASLNAGETTYSLEHASDLRVEVQKVYELIDALSKKILTLGLNQDPPPHPSNLRLQRMIRYSATLFVQEKLLGLMSLPTKEQFEELKKKRKEEMERKRAVERQAALESQRRLEERQSGLASRAANGEVASLRRGPAPLRKAEGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRMDEVRTLQENLRQLQDEYDQQQTEKAIELSRRQAEEEDLQREQLQMLRERELEREREQFRVASLHTRTRSLDFREIGPFQLEPSREPRTHLAYALDLGSSPVPSSTAPKTPSLSSTQPTRVWSGPPAVGQERLPQSSMPQQHEGPSLNPFDEEDLSSPMEEATTGPPAAGVSLDPSARILKEYNPFEEEDEEEEAVAGNPFIQPDSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEMDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQCGRLDEVEVLTENLRELKHTLAKQKGGTD q5zsm7_legph lepB lpg2490 protein protein legph Legionella pneumophila subsp. pneumophila MLIYQGKEIVRFKEKTGGKNKSDVDGFYKDNDGGKFFIKKPGDPRELFTELFAGLLLKEFMKRGLIDESYFPSLICADVIQFEDKSYGLIQPLVSFDELHKVIGTSSGDGKDRNTLKETLFGPGYYAGITKQNKYFGLSMALMFSLLLGAHSVHSGNIVVLNGEEKEKSKQFGRIDWGDAFRYFAHPNNNDNLLYAYENRGWFNYKSLTKDYFLNYKKINGLFPAMAEKARQLQSKLNPELLVKIVTSALKNIPADLIDEKTKIQLAAYMCMDSFKEATFGTEGNCKDFAIAMATLLENRLGKIAVLKDMSPLSNPEELYQSILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISGKKTAGQIDELQKIVISLQSKIKRQTIEFEELEATLIQIKEKYQLLEKMAEQSEHEKSSAQSIIRSLNLELSQLKLQLQEQEKLQFQLKELKEKIHEQTTLSKRLGEELQTQKKTNTHQEETIQRITKEKSLADSSLESLRKELHELAKKERSLHKTLEEKQLQVQQLEEQLAEKEKENLALKKADKQSQHEKSLDKSAIESLTSELNQLKLELQKQETLQLQLKSLRKQIQEQTLVVEGLKEELQKQKKSNTHQEETIERITKEKSLADSALESLRKEMYELTRKNEENQLKLTKQVHSLSEQLEEKQLQIREFEKQLQEKEKRVEQSEKGKASAKRTVASLREQVSNLKLQLQQLGEVIQEKEKGSSLISQQSKQIIALQEIIEDQKRQLEELKIKIQELVSANQELGKQNQSLSKENLHNKNTVEDLKKKLNELNVQLEQLHQSSNEKEQTIRKLREELIKKDSSLKQNEEMQLAQKHLQEEIDRLQKEIKQQQLNTNQLESIIAQSKEAEKRYQQALQQKKGIYFARMERVSPIYLQIQQIEQKAKELEERRETEASTAAKTLATKLRLEIKNYLDNNESDEKSALNSFKINAKRHIENSKETLNQHREEWKYLLANVTLGVFLLGIGYLAAILINKATTGNYTFFSQTNSGKKLDALEKAISSTHSETLVYG rab1b_human Ras-related protein Rab-1B RAB1B protein protein human Homo sapiens Human MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC rab1a_human Ras-related protein Rab-1A YPT1-related protein RAB1A RAB1 protein protein human Homo sapiens Human MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC drra_legph Multifunctional virulence effector protein DrrA lpg2464 drrA Defects in Rab1 recruitment protein A sidM protein protein legph Legionella pneumophila subsp. pneumophila MSIMGRIKMSVNEEQFGSLYSDERDKPLLSPTAQKKFEEYQNKLANLSKIIRENEGNEVSPWQEWENGLRQIYKEMIYDAFDALGVEMPKDMEVHFAGSLAKAQATEYSDLDAFVIVKNDEDIKKVKPVFDALNNLCQRIFTASNQIYPDPIGINPSRLIGTPDDLFGMLKDGMVADVEATAMSILTSKPVLPRYELGEELRDKIKQEPSFSNMVSAKKFYNKAIKDFTAPKEGAEVVSVKTHIMRPIDFMLMGLREEFNLYSEDGAHLSAPGTIRLLREKNLLPEEQIARIESVYNQAMSKRFELHAEHKKEHDEMPYSDAKAMLDEVAKIRELGVQRVTRIENLENAKKLWDNANSMLEKGNISGYLKAANELHKFMKEKNLKEDDLRPELSDKTISPKGYAILQSLWGAASDYSRAAATLTESTVEPGLVSAVNKMSAFFMDCKLSPNERATPDPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTKALMNHKIAAIQKLERSNNVNDETLESVLSSKGENLSEYLSYKYATKDEGREHRYTASTENFKNVKEKYQQMRGDALKTEILADFKDKLAEATDEQSLKQIVAELKSKDEYRILAKGQGLTTQLLGLKTSSVSSFEKMVEETRESIKSQERQTIKIK mint q5ztm4_legph legK2 lpg2137 protein protein legph Legionella pneumophila subsp. pneumophila MVYYINLKEQPLHQDKEILTQLIKQYLLSGSSQSALFANHPYTLNDEDGNEIEFLLSHDIYKNQREDGITEFLILNGSQIGRGTKGVVIQSNHAMYLIDDELVIFPKENVLKVLYQNFINAEELIKQESVNYSILSGNSTAELVNLQGGNQGFFMQKEEGYALEELLEDIDSLQKLTFSDKMELAISFLTELENLHNKGYAHGDLTFKNILYNEKNNQLKIIDAGEMKVADERFWAQDISIAIEMISLLFTTNETNQFKASRYWSDEPTVRRIVNPNPVEAKLNRILNSEYRCVSDLKLAIERNYNEYLNNSNLVLKKNVELESEALGLQAYKNQMSKQQLLGEIQGFKENYWNMKDLLTLTNRHHLRVFLEYLDNICSAFKDDKTDEKSARAAYDFLNAQINKLFEDNSKNSKPSFESFSEDVQRFLIHIDTYLMKNPSACSNSIASTIQLLKQLDNKKSFNPEQSFKDFCSYKEITIQLLLKPFETPVAEMASAPAIASDLIEKQSDTKRKLQEMKSSANQDKQPIFTPSLMRGPS arp3_human Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 protein protein human Homo sapiens Human MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS arc1b_human Actin-related protein 2/3 complex subunit 1B Arp2/3 complex 41 kDa subunit p41-ARC ARPC1B ARC41 protein protein human Homo sapiens Human MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK drra-rab1a-1 895999 q5zsq3_legph SidM/DrrA 896004 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 895999 mint sf2b f6 drra-rab1a-2 895999 q5zsq3_legph SidM/DrrA 896004 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified rab1a_human Rab1 896005 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 895999 sf2b mint drra-rab1a-3 895999 q5zsq3_legph SidM/DrrA 896004 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q5ZSQ3:p.Ala435Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 895999 f3b mint drra-rab1a-4 896000 q5zsq3_legph SidM/DrrA 896004 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint sf5 drra-rab1a-5 896000 q5zsq3_legph SidM/DrrA 896004 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5ZSQ3:p.Ala435Glu mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component partially purified partially purified physical association physical association false false false f2d mint drra-rab1a 896001 q5zsq3_legph SidM/DrrA 896004 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint st1 f1 sf1 drra-rab1a-6 896002 q5zsq3_legph SidM/DrrA 896004 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5ZSQ3:p.Ala435Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component partially purified partially purified physical association physical association false false false mint f2b f2d f3d q5zzb6 1478445 n/a LpcN-II 1478447 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false t2 f4 q5zzb6-1 1478446 n/a LpcN-II 1478447 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 4.0 direct interaction direct interaction false false false sf1d sf4 lepb 1386776 n/a LepB 1386777 unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 direct interaction direct interaction false false false table 1 fig 1 Rworking = 0.2 Rfree = 0.24 2.8A lepb-rab1b 1386776 n/a LepB 1386777 unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a Rab1b 1386778 unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 1386786 1386784 direct interaction direct interaction false false false table 1 fig 2 fig 4 2.7A R-Value: 0.219 R-Free: 0.249 ankx-1 3932886 N/A 3932891 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f1b f1c gpbp1-ankx-1 3932886 N/A 3932893 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f1b f1c cyp4f8-ankx-1 3932886 N/A 3932894 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f1b f1c plekha4-ankx-1 3932886 N/A 3932895 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f1b f1c micall1-ankx-1 3932886 N/A 3932896 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f1b f1c micall1-ankx-2 3932886 N/A 3932897 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f1b f1c dbn1-ankx-1 3932886 N/A 3932898 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f1b f1c zcchc10-ankx-1 3932886 N/A 3932899 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f1b f1c plekhn1-ankx-4 3932886 N/A 3932900 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 q0pak7_camje-plekhn1-1 3932886 N/A 3932901 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 rnf216-plekhn1-1 3932886 N/A 3932902 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 naa60-plekhn1-1 3932886 N/A 3932903 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 birc8-plekhn1-1 3932886 N/A 3932904 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 birc8-plekhn1-2 3932886 N/A 3932905 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 psmb5-plekhn1-1 3932886 N/A 3932906 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 psmb5-plekhn1-2 3932886 N/A 3932907 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 q5zwz3_legph-plekhn1-1 3932886 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932908 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 Positive control rab35-plekhn1-1 3932886 N/A 3932909 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932891 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false SF7 Positive control plekhn1-ankx-1 3932887 N/A 3932891 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f2a f2b gpbp1-ankx-2 3932887 N/A 3932893 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f2a f2b zcchc10-ankx-2 3932887 N/A 3932899 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f2a f2b micall1-ankx-3 3932887 N/A 3932896 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f2a plekha4-ankx-2 3932887 N/A 3932895 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3932892 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false f2a f2b plekhn1-ankx-2 3932887 N/A 3932891 unspecified role unspecified role prey prey purified purified HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3932892 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false f3a ankx-plekhn1-2 3932888 N/A 3932891 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3932892 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q5ZXN6:p.His229Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false f5 HaloTag-AnkXH229A accumulated less on the plasma membrane ankx-plekhn1-3 3932888 N/A 3932891 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3932892 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell mcherry tag mcherry tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false f6 In turn, the mCherry-AnkX491-809 fragment showed a speckled distribution in the nucleus and extensively co-localized with PLEKHN1. ankx-plekhn1-1 3932889 N/A 3932891 unspecified role unspecified role bait bait purified purified HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3932892 unspecified role unspecified role prey prey purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false f3b plekhn1-ankx-3 3932890 N/A 3932891 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3932892 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell HaloTag HaloTag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false f3c legas4-cbx5-3 1459212 n/a 1459217 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459218 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2d legas4-cbx5-4 1459212 n/a 1459218 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified P45973:p.Ile165Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 1459217 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2e legas4-cbx5-5 1459212 n/a 1459218 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified P45973:p.Trp174Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 1459217 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2e legas4-cbx5-6 1459212 n/a 1459217 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1459218 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false f2f legas4-npm1 1459213 n/a 1459217 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1459219 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f1b sf1c npm1-q7wdl8 1459213 n/a 1459220 tag visualisation tag visualisation unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459219 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3b npm1-q7wdl8-1 1459213 n/a 1459221 tag visualisation tag visualisation unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459219 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3b cbx5-legas4 1459214 n/a 1459217 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459218 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2a legas4-cbx5 1459214 n/a 1459222 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459217 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2a legas4-cbx5-1 1459215 n/a 1459217 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459218 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2b legas4-cbx5-2 1459215 n/a 1459217 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459222 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2b cbx5-legas4-1 1459216 n/a 1459217 tag visualisation tag visualisation unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459223 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false sf3 rab5c-vipd-5 3937642 N/A 3937648 unspecified role unspecified role prey prey purified purified P51148:p.Gln80Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P51148:p.Arg92Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3937649 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3937642 f7b f7c sf6 eea1-rab5c-2 3937642 N/A 3937648 unspecified role unspecified role prey prey purified purified P51148:p.Gln80Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P51148:p.Arg92Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3937650 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3937642 f7b f7c sf6 rbsn-rab5c-2 3937642 N/A 3937648 unspecified role unspecified role prey prey purified purified P51148:p.Gln80Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P51148:p.Arg92Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3937651 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3937642 f7b f7c sf6 rabep1-rab5c-1 3937642 N/A 3937648 unspecified role unspecified role prey prey purified purified P51148:p.Gln80Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P51148:p.Arg92Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3937652 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false f7b f7c sf6 rab5c-vipd-2 3937643 N/A 3937648 unspecified role unspecified role prey prey purified purified P51148:p.Gln80Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3937649 unspecified role unspecified role bait bait purified purified Q5ZRP9:p.Phe442Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q5ZRP9:p.Gln449Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.His453Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Glu461Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Tyr473Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Gln476Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Asp479His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Asp484His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false f4a rab5c-vipd-3 3937643 N/A 3937648 unspecified role unspecified role bait bait purified purified P51148:p.Phe58Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P51148:p.Glu73Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P51148:p.Trp75Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P51148:p.Arg82Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P51148:p.Tyr83Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P51148:p.Met89Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P51148:p.Gln80Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P51148:p.Tyr90Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P51148:p.Arg92Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3937649 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false f4b rab5c-vipd-4 3937643 N/A 3937653 unspecified role unspecified role prey prey purified purified Q9UL26:p.Gln64Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3937649 unspecified role unspecified role bait bait purified purified Q5ZRP9:p.Phe442Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q5ZRP9:p.Gln449Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.His453Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Glu461Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Tyr473Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Gln476Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Asp479His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Asp484His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false f4C rab5c-vipd-1 3937644 N/A 3937648 unspecified role unspecified role neutral component neutral component purified purified P51148:p.Gln80Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3937649 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false f1 f2 t1 sf1 he final model for the VipD19–564-Rab5c18–182(Q80L)-GppNHp structure was refined at 3.1 Å, with values for Rfactor and Rfree of 0.23 and 0.28, respectively rab5c-vipd-6 3937645 N/A 3937648 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P51148:p.Gln80Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3937649 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Q5ZRP9:p.Phe442Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false mcherry tag mcherry tag mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q5ZRP9:p.Gln476Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q5ZRP9:p.Glu461Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) colocalization colocalization false false false f5 The figure shows Rab5a-Q79L, not Rab5c-Q80L, but the text refers to Rab5c-Q80L. We believe it is probably a typo error and curated the interaction with Rab5c. rab5c-vipd-7 3937646 N/A 3937648 unspecified role unspecified role neutral component neutral component purified purified P51148:p.Gln80Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3937649 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false sf3 Small angle X-ray scattering (SAXS) and gel filtration chromatography analysis suggest a heterodimeric VipD1–621–Rab5c18–182(Q80L) complex in solution, indicating that N18 was not involved in any oligomer formation (Fig. 6 A and B and Fig. S3). rab5c-vipd-8 3937647 N/A 3937648 unspecified role unspecified role neutral component neutral component purified purified P51148:p.Gln80Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3937649 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false f6 Small angle X-ray scattering (SAXS) and gel filtration chromatography analysis suggest a heterodimeric VipD1–621–Rab5c18–182(Q80L) complex in solution, indicating that N18 was not involved in any oligomer formation (Fig. 6 A and B and Fig. S3). actr3-arpc1b-1 3322742 N/A 3322745 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3322746 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f1a legk2-actr3-1 3322742 N/A 3322747 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3322746 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f1a actr3-arpc1b-2 3322743 N/A 3322747 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3322746 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false f1c arpc1b-legk2-2 3322743 N/A 3322745 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3322746 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false f1c arpc1b-legk2-1 3322744 N/A 3322745 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322746 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false f1b DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhao-2011-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhao Y., Yang J., Shi J., Gong YN., Lu Q., Xu H., Liu L., Shao F. DIP original experiment: DIP-218894X Nature 2011 IMEx The NLRC4 inflammasome receptors for bacterial flagellin and type III secretion apparatus. Zhao Y., Yang J., Shi J., Gong YN., Lu Q., Xu H., Liu L., Shao F. Only protein-protein interactions imex curation belyi-2006-1 in vitro In vitro glycosylase assay glycosylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Belyi Y., Niggeweg R., Opitz B., Vogelsgesang M., Hippenstiel S., Wilm M., Aktories K. DIP original experiment: DIP-264047X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Legionella pneumophila glucosyltransferase inhibits host elongation factor 1A. Belyi Y., Niggeweg R., Opitz B., Vogelsgesang M., Hippenstiel S., Wilm M., Aktories K. Only protein-protein interactions imex curation belyi-2006-2 in vitro In vitro glycosylase assay glycosylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Belyi Y., Niggeweg R., Opitz B., Vogelsgesang M., Hippenstiel S., Wilm M., Aktories K. DIP original experiment: DIP-264048X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Legionella pneumophila glucosyltransferase inhibits host elongation factor 1A. Belyi Y., Niggeweg R., Opitz B., Vogelsgesang M., Hippenstiel S., Wilm M., Aktories K. Only protein-protein interactions imex curation abbas-2020-2 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes experimental particp experimental participant identification experimental particp Abbas YM., Wu D., Bueler SA., Robinson CV., Rubinstein JL. john.rubinstein@utoronto.ca Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation abbas-2020-1 in vitro In vitro 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single experimental particp experimental participant identification experimental particp Abbas YM., Wu D., Bueler SA., Robinson CV., Rubinstein JL. john.rubinstein@utoronto.ca Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation quaile-2015-2 in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Quaile AT., Urbanus ML., Stogios PJ., Nocek B., Skarina T., Ensminger AW., Savchenko A. DIP original experiment: DIP-266593X Structure (London, England : 1993) 2015 IMEx Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila. Quaile AT., Urbanus ML., Stogios PJ., Nocek B., Skarina T., Ensminger AW., Savchenko A. Only protein-protein interactions imex curation tenthorey-2017-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tenthorey JL., Haloupek N., López-Blanco JR., Grob P., Adamson E., Hartenian E., Lind NA., Bourgeois NM., Chacón P., Nogales E., Vance RE. rvance@berkeley.edu Science (New York, N.Y.) 2017 imex curation Only protein-protein interactions imex curation tenthorey-2017-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Tenthorey JL., Haloupek N., López-Blanco JR., Grob P., Adamson E., Hartenian E., Lind NA., Bourgeois NM., Chacón P., Nogales E., Vance RE. rvance@berkeley.edu Science (New York, N.Y.) 2017 imex curation Only protein-protein interactions imex curation schoebel-2011-1 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250176X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250171X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-3 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250178X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250174X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250172X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250175X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-7 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250177X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250173X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation banga-2007-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261212X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261207X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261196X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261202X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261197X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261203X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-7 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261213X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261198X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-9 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261208X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261204X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261199X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261205X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-13 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261209X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261200X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-15 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261211X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-16 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261210X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261201X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation banga-2007-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. DIP original experiment: DIP-261206X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Legionella pneumophila inhibits macrophage apoptosis by targeting pro-death members of the Bcl2 protein family. Banga S., Gao P., Shen X., Fiscus V., Zong WX., Chen L., Luo ZQ. Only protein-protein interactions imex curation ge-2009-1 in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Ge J., Xu H., Li T., Zhou Y., Zhang Z., Li S., Liu L., Shao F. DIP original experiment: DIP-216477X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A Legionella type IV effector activates the NF-kappaB pathway by phosphorylating the IkappaB family of inhibitors. Ge J., Xu H., Li T., Zhou Y., Zhang Z., Li S., Liu L., Shao F. Only protein-protein interactions imex curation ge-2009-3 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Ge J., Xu H., Li T., Zhou Y., Zhang Z., Li S., Liu L., Shao F. DIP original experiment: DIP-216476X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A Legionella type IV effector activates the NF-kappaB pathway by phosphorylating the IkappaB family of inhibitors. Ge J., Xu H., Li T., Zhou Y., Zhang Z., Li S., Liu L., Shao F. Only protein-protein interactions imex curation farelli-2013-1 ecolx Escherichia coli pull down pull down weight by staining molecular weight estimation by staining weight by staining Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. DIP original experiment: DIP-254627X Structure (London, England : 1993) 2013 IMEx IcmQ in the Type 4b secretion system contains an NAD+ binding domain. Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. Only protein-protein interactions imex curation farelli-2013-2 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by staining molecular weight estimation by staining weight by staining Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. DIP original experiment: DIP-254628X Structure (London, England : 1993) 2013 IMEx IcmQ in the Type 4b secretion system contains an NAD+ binding domain. Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. Only protein-protein interactions imex curation farelli-2013-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. DIP original experiment: DIP-254629X Structure (London, England : 1993) 2013 IMEx IcmQ in the Type 4b secretion system contains an NAD+ binding domain. Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. Only protein-protein interactions imex curation q00653-1 Nuclear factor NF-kappa-B p100 subunit p100 NFKB2 LYT10 DNA-binding factor KBF2 H2TF1 Lymphocyte translocation chromosome 10 protein Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 Oncogene Lyt-10 protein protein human Homo sapiens Human MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH q5zvf7_legph Non-specific serine/threonine protein kinase legK1 lpg1483 protein protein legph Legionella pneumophila subsp. pneumophila MPRTMFFSVDAANLQNLQITNQKAFAALESYLNDNDSPGAWNNNQGYKYTHKDVTYCFSFNQSLVRRPRKSDQKKHTFEIFDPNKNPLGKGAYGIVYPILGTIQFEFGNAIKRPPKNKLVKIQNHSERDQSHSVLREYQGLLQSGHIAVKPPIFVENKESKFSYLIMEKAEGIVLEKFLNPIKRLDLSEEVPELNLINRIEITFAILKAIKEQVTDKHLIHRDIKPGNIIIDFSKSPPIAKVIDFGFVLRASEQDYRRCGTRAYRAPESFNTQALYTAKADVWSTGRILSYLWGDKYTNYYISRDKGLDYVIEKSRNELLFSDPELELYLTKEDKSKIRSCLSAMLIVDPEERGSIDKAIKQFSQIDFEKYKRLKRSTNFEIDLTDNDIKLRKQLNSIHLHLITLQSKEKDLRNRACFDAANAMSQLVSKLTAYTNYLEKNPDPFLIKRYKECCIAEIDLANLTLQNHRDALWLVAELSTAILLLGIGYLFAFGINYYNTGRLGLFSQTRSEKLVEEMKSSVLGIAVGN ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL q5zyc9_legph icmR lpg0443 protein protein legph Legionella pneumophila subsp. pneumophila MGNNTDDSARNPFGFYTPPRVKEIGEPDVTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQPILTTKTERMFGAAESEKSSEPPSHDERGFKLSS a5ihf0_legpc A5IHF0_LEGPC protein protein legpc legpc This sequence has been withdrawn from Uniprot. lubx_legph E3 ubiquitin-protein ligase LubX Legionella U-box protein lubX legU2 lpg2830 RING-type E3 ubiquitin transferase LubX protein protein legph Legionella pneumophila subsp. pneumophila MGYRIEMATRNPFDIDHKSKYLREAALEANLSHPETTPTMLTCPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKDLQPFPELLIIVNRFVETQTNYEKLKNRLVQNARVAARQKEYTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQQIKVYNFYRKREMQKNQIQPSVSSGFGFFSLNFLTSWLWGTEEKKEKTSSDMTY q5zs31_legph icmW lpg2688 protein protein legph Legionella pneumophila subsp. pneumophila MPDLSHEASAKYWFEYLDPMIYRVITFMESVENWTLDGNPELEEAMKQLGQELDDIEKIDLGLLAEEDKFIRIVGNIKSGRGLRLLQAIDTVHPGSASRVLIHAEETSLSSSDPAGFFLKRNIVFERLRLLSRVFCQYRLKLVLRALEGDE q5zrq1_legph sidH lpg2829 protein protein legph Legionella pneumophila subsp. pneumophila MKRTIETYIIYLKEDLKIADTCKTIKDGLLKSITDKTHFSEELATYFERDNPNAPFKVNTTDPTQVAVLKKLLNALENAEKSFRAIENIDISRDRYTAMIAKDAVMVSYKAVHEIYAALQLINHSNSDIQDIVGPHIQKLLPQMALASKALGNFAPEHPEESAGAVLAGVVNMLPTEKPTESESLGKLSNLIFELPHYFEELQKLIATGASGIATKSITSAEDYQSAMIKKANETKYYFEQLSSKSGLLAIPSYLSIVKRLIAHSTDLVNAGAPLTKQAYLDAVAKLEDIKHNILPQLISELEMVEESMGLKPGLLTDPALEQMNKYYTQLAEQVDNIAKAAGVLDTVSDYSDSIGGKIVRFLAGDSKKLDVGPKLTPAPDLGVLMDDVFIQKRRSNQESRLNEARLSSEDKSVLAAANRFFDKIGSYNSIHKAWSKWSLANISQSEKDALIKEYKQFQPHFAALYPDIDKLVVDALTQPTGSNIVSRLYSSDYKQLWSSDHFKQVLSCKDSVLSSIQQSLAQSEFKAKLIEKTMSHSEETAYSMNNKTTNLTTRVQPFEPLKFTLEDDKPVEYYHKRVIAASNQILELERAQKGVAEFFNYIQKKYPHENPSFDSLDESDKEFLRKAYKTFQPQLLALKHDDINTRLVSSLTSSKPTDPPLRLTDLVSLKSGINDYLNEKISDLNQDKTTLLDKEEEAREEQYAKNPLVAKGAELEKQTLFGQMSKLKLSKSVDDFFNKKFQTYLKDNLSPEVWKQLSSNGETLDFDKIPYLEFHKDSPEVAMYKQLINSMHYMKNGLEKLESLNDYGDPNNIYHRTRFVMTTFNALVMNICFSKYYVMEAGNNPGLKAIVQEGLDLLKPLEGMPLIGDYLKTTEKQEPPKQNIITAWKKQQAVVESGLSKGPKPKTDQQLISEQLGKIQEAIDNFDGDLEVSDSAREKIKTQIGEFAKGISGLSFGPGSVKKILAALTKLETQLSNLDKESPEVTLGKLKDIHSELNAQFRAAAEYTEYHSGQKFGSYSNNISTIVSNFCNGLVSNLPLKQEPAPKVKAPEKPVTPVITGTTNPHEVVFGTKHEEFNSVYQPYLLLKRITDEFRDQNNPYKPSFDELKEEAVSYYDKIQPLLESVDPKFDKNFIAKHKESSTLLKAIDEVMSMRQRINNPESSFAKLKDLHLEGDFEKEENKEKFRQLYKEIQPYLHKIDSTYDQTQFLEGLKTAKDFSGALQRIMNEENALQQSTSLKDTSYLQLIAESLYQIPVKLNKLKAEPDTPEPSKEEIDANVKAFVEGLNGLSFGPGSVKKILSTAAKLQMQLSDIGKEGRELTMGRLKEIQAEFGTILMAAADNAEFHLGLKPGTYSRTVSERFEKFYSSLIVNLPLEKDQTGLELLIDTTSTQKRLAREMERLESVKEDTSAIDTKKSIFGTEHEQFSTLYQPYASLRHIAKDIEDGVHMNLYERTLEELKEEASNEYKKIQPYLAKINPEFTEDYISKTDGEYSLLHAIDRVFEERHKINKPSSPFDKLRDLYLDGDFEKEENKEQFLQLYAELQPHLIKINYQYDLAYFLRELQTPEDFKAATERIINDESKLQELITGLDDTKRLKVKLCEERIGYFIDLLKKQELEVGPEKIQAFKEKIFFNYIHANVNSALDAKIGSHAEQFLQFIEKDFLDKKNEILEKITIDQDMEEEIAKAIDRIAPDIINNKIESFKKLLFDSYIQSDIKNSLHNELGIYTSLFIDKISPEIHLHQSEILGNVAFDSKMGAEIGSKINAITPGILLNNNPLKEAYVDLNNTLKEINTLLDEENKKTRDNPCRNEKIAKLTSLKDRLSDLDSIPKENTVEFLKKMQEETRSSLKSLESNDALINIYDVLNSLKETIENGSDLPEIKKDKLQMISDVQNILSNFDKNPAERLNLAVQILNDSNPEVLSKTKGNFLIGEAFKGQVFTNYINTKISEQLNNELGPYGKVFLKQIMPDFIAKKSEIIKEIAIDNMETGLETQFKIHAPAIFEKNKELKAAYEQLNVHLKEVQSLIEAEEKKPKGNPCREEKIAALRSHQSQLMNTQRIPDHETLRFLQEQNKSAKSFMGKLEKYDTMISVYDSLTEIREHVSNHKSLSKEIKDEKIQEISKMEDMLKTTSKEPSIRLAEVKAHGLSDQCKNVLLKNSDNFLVSFFKTLFSKLFNIKNENETLVSSFKQRLQNIKGPEPVATPMETPENEAPLVNANITRF ef1a1_human Elongation factor 1-alpha 1 EEF1A1 EEF1A EF1A LENG7 Eukaryotic elongation factor 1 A-1 Elongation factor Tu Leukocyte receptor cluster member 7 protein protein human Homo sapiens Human MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK q5zvs2_legph lpg1368 protein protein legph Legionella pneumophila subsp. pneumophila MKARRDQQLSKLRMRFFSALNHTSEIDLQVLFNDLKSILTLDSIEHLKEGSVAYAIIQELLKQDDAQNKIQSFLHGAIKNVIHPGVIKGLTPDEINWNVAKAYPKYYEHEEFPDVTFGGFKVRDSNEFKFKTNIQTSIWFSIKPDLFMPSKQQEALKRRREQYPGCEIRLIYSSSLLNAEANRQMKAFARKQNISLIDIDSVKTDSPLYPLLKAELAHLGKGGNPAAASDLCRWIPELFNEGFYVDIDLPVDSSKIVEGHQITGGVPIMLNMGSIISEPIAPHHRRQEAVCMNTDIIAYSNDKRTQKMMDTVARYLKNIYDDPYTALKDTPLAQTAFFNKCQEERKSIFDLRKGLQDAFRSDSLLQLYDFLGADKFKEVFKLKEAQSKYINEHISEFSEKDLLLNLISDKPSEISQHTLDFVKAKAMYIDIAKEHYSAFYKPLVEEISGPGAIYNALGGAGSFTTTHRRLTGPMLPTTPPRVLQVFCDAHDKGPFVSDNIARWQTNVRDLGVLNREGLSWLPSVG ef1a2_human Elongation factor 1-alpha 2 EEF1A2 EEF1AL STN Eukaryotic elongation factor 1 A-2 Statin-S1 protein protein human Homo sapiens Human MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK q5zwz3_legph lpg0940 protein protein legph Legionella pneumophila subsp. pneumophila MAKDNKSHQVKTSEGSLESVKTKEKEPVLEKMRVEDSKKEDKLSMPTTKKESQPNEPVKPFKTSFEKWIESSLLDPQAKEDRGSTINLGREGLKNASQVKKFLLSPAGKDVIAELGAQMALQRNINLQNQQDRMEHELFKRRLMAALFLWYLSKKSHAAEKVKEIIREYNEKAIKNAEKASKPSQQSTSSTSQADKEIQKMLDEYEQAIKRAQENIKKGEELEKKLDKLERQGKDLEDKYKTYEENLEGFEKLLTDSEELSLSEINEKMEAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAHLAINKDQEVVEHEGQFYLLQKGQWDAIKNNPAALEKAQKDYSQSKHDLATIKMEALIHKLSLEMEKQLETINNLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVHRKEKSFFNEKGEEVTSLNDAHYVIGKDQQLFNLGGKFYPIHKEQKILEKDGKFYLLKQGEDWESIKDSPEKQKKAEHDFHKLQYETPMTVKKLVHHNKGLETTIHKERVEETKQQLEDNGKEKIEIANNISKLQSTVGVALNQLNQPTLDTESPVLTPSGGSTTSSPKPTPSLASVTTFFKTKIDEMKKNENVKVTFDDLLALSIKIADPKARTYFTGELLKEVPRSGAIPFQTMQRMLQTLEQYGVDTTKPSVTSIRSKTDEVLEQRFNPTPSLSPFKTS rab1b_human Ras-related protein Rab-1B RAB1B protein protein human Homo sapiens Human MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC p20340-1 Ras-related protein Rab-6A Rab-6a RAB6A RAB6 protein protein human Homo sapiens Human MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL va0e2_rat V-type proton ATPase subunit e 2 Atp6v0e2 Vacuolar proton pump subunit e 2 protein protein rat Rattus norvegicus (Rat) Rat MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE q5m7t6_rat V-type proton ATPase subunit Atp6v0d1 rCG_51062 protein protein rat Rattus norvegicus (Rat) Rat MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF vas1_rat V-type proton ATPase subunit S1 V-ATPase S1 accessory protein V-ATPase Ac45 subunit C7-1 protein Atp6ap1 Atp6ip1 Atp6s1 Vacuolar proton pump subunit S1 protein protein rat Rattus norvegicus (Rat) Rat MMAATVVSRIRTGTRWAPVLWLLLSLVAVAAAVAAEQQVPLVLWSSDRDLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLESEDVPYTAALTAVRPSRVARDVAMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAYKDEWKDLTSLTFGVENLNLTGSFWNDSFAMLSLTYEPLFGATVTFKFILASRFYPVSARYWFTMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSLSKKGSLLVTNVPSLWQMTLHNFQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDRKGPTITLTQIV b0k022_rat Atp6v0b Atp6v0b_predicted rCG_50448 protein protein rat Rattus norvegicus (Rat) Rat MTGLELLYLGIFVAFWACMIVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD p25286-1 V-type proton ATPase 116 kDa subunit a1 Atp6v0a1 Atp6n1 Vpp1 Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit Vacuolar adenosine triphosphatase subunit Ac116 Vacuolar proton pump subunit 1 Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1 protein protein rat Rattus norvegicus (Rat) Rat MGELFRSEEMTLAQLFLQSEAAYCCVSELEELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPNEMGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTIGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPESGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE vatc1_rat V-type proton ATPase subunit C 1 Atp6v1c1 Vacuolar proton pump subunit C 1 protein protein rat Rattus norvegicus (Rat) Rat MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFKKAVDDFRHKARENKFIVRDFQYNEEEMRADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK vate1_rat V-type proton ATPase subunit E 1 Atp6v1e1 Vacuolar proton pump subunit E 1 protein protein rat Rattus norvegicus (Rat) Rat MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDLEAYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD q6p503_rat V-type proton ATPase subunit D Atp6v1d V-type proton ATPase subunit d Vacuolar proton pump subunit D rCG_61537 protein protein rat Rattus norvegicus (Rat) Rat MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKIIKEKSEKDLERRRAAGEVMEPANLLAEEKDEDLLFE vatb2_rat V-type proton ATPase subunit B, brain isoform Vacuolar proton pump subunit B 2 Endomembrane proton pump 58 kDa subunit Atp6v1b2 Atp6b2 Vat2 protein protein rat Rattus norvegicus (Rat) Rat MALRAMRGIVNGAAPELPVPTGGPMAGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFITQGPYENRTVYETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH d4a133_rat H(+)-transporting two-sector ATPase rCG_52629 Atp6v1a protein protein rat Rattus norvegicus (Rat) Rat MDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRSRGSVTYIAPPGNYDASDVVLELEFEGVKEKLSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDMQNAFRSLED renr_rat Renin receptor Atp6ap2 Atp6ip2 ATPase H(+)-transporting lysosomal accessory protein 2 ATPase H(+)-transporting lysosomal-interacting protein 2 Renin/prorenin receptor protein protein rat Rattus norvegicus (Rat) Rat MAVLVVLLSSLVSSALANEFSILRSPGSVVFRNGNWPIPGDRIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATIMVTVKGVDKLALPTGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLNSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDELGKRYGEDSEQFRDASRILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLVRKSRTILETKQENTQSPYNLAYKYNLEYSVVFNLVLWIMTGLALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD vatl_rat V-type proton ATPase 16 kDa proteolipid subunit Atp6v0c Atp6c Atp6l Atpl Vacuolar proton pump 16 kDa proteolipid subunit protein protein rat Rattus norvegicus (Rat) Rat MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK d3zim6_rat Rnasek protein protein rat Rattus norvegicus (Rat) Rat MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR q5zww6_legph lpg0968 protein protein legph Legionella pneumophila subsp. pneumophila MSFIKVGIKMGGLTSEQYHSQVVGKIGYIARCMQTIDPENNLKKIREDYQDVLIWAEKNYRFEEILEASKSGKCPNDLDALSRRSLILQELLRLVSSISPFKMKLDLIESQYEKMKQHVNLWKSDYHVKLNQLNQLTDYLKNAAPTPKNNFLRAMTSVLQMQIAQYGITEDNEGINQLFKLGLHLLAMANEKIDEQYHLFKGYVKDQPEESPFEGILPAEDQKILVKTMIDYAMPKLSSKVLQDKLSALSSSDVLTKTLLDSIDRIVKENEKLNALSKVKLGKFGLDIREIEVIYSQALKISPQDALQYTAQQCDAQLLSMAFPDSQNYIIESISNKKVKTIAELIHSKEFIYQIIKTEVFKQVDPNEKIRLQAATELYQLLGRIMDKQINLFTKMNLEQINEYIQTKTKAILDKIPERVELLTFMGFEIPTFKGIETLMTDISHSQDNETLAIAQEFYTNIKNAKNQLLGDKLIEDITPQDVEKFFNQCSQYGSEAAEKLADNRPVLTKIADILTAIARWAISLIGFNTPPQFLAPTRTCVDQVSDEITKIKLKLEDTLGSLQKVQEESLSL q8r2h0_rat V-type proton ATPase subunit G Atp6v1g2 Aif1 Bat1a Cdk2ap1-ps2 Cdk2ap1-ps3 Cdk2ap1-ps4 Cdk2ap1-ps5 Cdk2ap1-ps6 E230034O05Rik LOC224733l-3 LOC224733l-4 LOC224733l-5 LOC224733l-6 LOC224733l-7 LOC224733l-8 Lst1 RT1-CE12 RT1-CE3 RT1-CE5 RT1-CE6 RT1-CE8 RT1-CE9 Sacm2l-ps3 Sacm2l-ps4 Sacm2l-ps5 Sacm2l-ps6 Sacm2l-ps7 Tnf rCG_38311 protein protein rat Rattus norvegicus (Rat) Rat MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLTQLLGMVCDVRPQVHPNYRITV vatf_rat V-type proton ATPase subunit F Vacuolar proton pump subunit F V-ATPase 14 kDa subunit Atp6v1f Atp6s14 Vatf protein protein rat Rattus norvegicus (Rat) Rat MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR b2l13_human Bcl-2-like protein 13 Protein Mil1 Bcl-rambo BCL2L13 MIL1 CD003 protein protein human Homo sapiens Human MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVKTEIEEELKSLDKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLHKALQMLLSQPVTYQAFRECTLETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQFGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSNGAGEKSENNSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHITATSLLGTREPDTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREESLVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVALALRKK q5zsd5_legph sidF lpg2584 protein protein legph Legionella pneumophila subsp. pneumophila MPRITENIETYVTHLLSDLEPVPSQNQHLAYGYPGERQVFKDPMLDGKQVVVVNSQYDKHGRPVTGQPDVIQEANNYIDNLVAAAKSLIDKDKKGEKDLRKNAIDEMAKTFKKSISETIPSDKAKADLFSSKKSSANKDFLEQLAKVEGSLQQFTQAVAKASGHKLKALDKEGHNIRSHNRDTLIHRFKAPNSKEGEEQFIMYIPCGRYTKRQQRLMGKDESEVNRDHDTTSHKRSDLVLGNSSMARMIAGTRHSDGTVTIHHDSFSGPGARMPYSDFKGADDYKKLAIKAVTLINQEEVIQTLAQRQIDRMTNEDLWNKIPEEYRPDELPPDAEKARAQLIKLYVEHNPLSVTECYTQVVTAGQRVAAENQKEQFEYVRQMMDAFDGSKAKITIQTGSNTEVETAVGYQARMSSWGVNWFRQVGALNPLSDNSVTKNQNARFVNQMTDDVIRNLDKVAQNLGDYDKAGALHTLLKGPDVSDLNQQITEKENALKEVKGAYREALFSYFEEYQKGEGKWDQAKLDQLKNQVDGYEKSIKKQESAIYELHNQIDALRKAYYTEHKGQINKALQELKEQISPVIQNKETDPETKSRLQHFYNSCAYLTQAQELYYENTWHHGKNNFKLQTLMASLSCELDYANTKGCKSNNDRGQRLAQKIVGNALWTAMSEDGLYTGEFLDHRRTHGKEVSNVEQLDRELTTIQALHHTANTGVSGGKFEIQDKANFADNGLFGKVANFAKIKEMGPENAFTKNMGTKIKAGLGLGLLAAGGFVALTLLFPPAGLAVAALGIGVAAGAAIVAGVTFAATYLFGTAIDAINNKIEEGKIKSIVREGMKAASENSPQHKTEQKDHLTVNAKLHQQLGVTRESVLERQSTPKQEFEKPKDMTSKVDLTAAMEDDNRSESTPTPVNF bnip3_human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 BNIP3 NIP3 protein protein human Homo sapiens Human MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF 53967696EDA005E2 podxl_human Podocalyxin PODXL PCLP PCLP1 GCTM-2 antigen Gp200 Podocalyxin-like protein 1 protein protein human Homo sapiens Human MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL fkbp8_human Peptidyl-prolyl cis-trans isomerase FKBP8 FK506-binding protein 8 38 kDa FK506-binding protein FKBPR38 FKBP8 FKBP38 Rotamase protein protein human Homo sapiens Human MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL tmub2_human Transmembrane and ubiquitin-like domain-containing protein 2 TMUB2 FP2653 UNQ1897/PRO4343 protein protein human Homo sapiens Human MISRHLQNNLMSVDPASSQAMELSDVTLIEGVGNEVMVVAGVVVLILALVLAWLSTYVADSGSNQLLGAIVSAGDTSVLHLGHVDHLVAGQGNPEPTELPHPSEGNDEKAEEAGEGRGDSTGEAGAGGGVEPSLEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSLNITDNCVIHCHRSPPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTAPATVSLVGVTVFFSFLVFGMYGR hmox2_human Heme oxygenase 2 HMOX2 HO2 protein protein human Homo sapiens Human MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM gcp60_human Golgi resident protein GCP60 GOCAP1 GOLPH1 ACBD3 GCP60 Acyl-CoA-binding domain-containing protein 3 Golgi phosphoprotein 1 Golgi complex-associated protein 1 PBR- and PKA-associated protein 7 Peripheral benzodiazepine receptor-associated protein PAP7 protein protein human Homo sapiens Human MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR aqp1_human Aquaporin-1 Aquaporin-CHIP Water channel protein for red blood cells and kidney proximal tubule Urine water channel AQP1 CHIP28 protein protein human Homo sapiens Human MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK syne2_human Nesprin-2 SYNE2 KIAA1011 NUA Nuclear envelope spectrin repeat protein 2 Synaptic nuclear envelope protein 2 Nucleus and actin connecting element protein KASH domain-containing protein 2 protein protein human Homo sapiens Human MASSPELPTEDEQGSWGIDDLHISLQAEQEDTQKKAFTCWINSQLARHTSPSVISDLFTDIKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHALTFLRNRSIKLINIHVTDIIDGNPSIILGLIWTIILHFHIEKLAQTLSCNYNQPSLDDVSVVDSSPASSPPAKKCSKVQARWQMSARKALLLWAQEQCATYESVNVTDFKSSWRNGMAFLAIIHALRPDLIDMKSVKHRSNKDNLREAFRIAEQELKIPRLLEPEDVDVVDPDEKSIMTYVAQFLQYSKDAPGTGEEAQGKVKDAMGWLTLQKEKLQKLLKDSENDTYFKKYNSLLSFMESFNEEKKSFLDVLSIKRDLDELDKDHLQLREAWDGLDHQINAWKIKLNYALPPPLHQTEAWLQEVEELMDEDLSASQDHSQAVTLIQEKMTLFKSLMDRFEHHSNILLTFENKDENHLPLVPPNKLEEMKRRINNILEKKFILLLEFHYYKCLVLGLVDEVKSKLDIWNIKYGSRESVELLLEDWHKFIEEKEFLARLDTSFQKCGEIYKNLAGECQNINKQYMMVKSDVCMYRKNIYNVKSTLQKVLACWATYVENLRLLRACFEETKKEEIKEVPFETLAQWNLEHATLNEAGNFLVEVSNDVVGSSISKELRRLNKRWRKLVSKTQLEMNLPLMIKKQDQPTFDNSGNILSKEEKATVEFSTDMSVELPENYNQNIKAGEKHEKENEEFTGQLKVAKDVEKLIGQVEIWEAEAKSVLDQDDVDTSMEESLKHLIAKGSMFDELMARSEDMLQMDIQNISSQESFQHVLTTGLQAKIQEAKEKVQINVVKLIAALKNLTDVSPDLDIRLKMEESQKELESYMMRAQQLLGQRESPGELISKHKEALIISNTKSLAKYLKAVEELKNNVTEDIKMSLEEKSRDVCAKWESLHHELSLYVQQLKIDIEKGKLSDNILKLEKQINKEKKLIRRGRTKGLIKEHEACFSEEGCLYQLNHHMEVLRELCEELPSQKSQQEVKRLLKDYEQKIERLLKCASEIHMTLQPTAGGTSKNEGTITTSENRGGDPHSEAPFAKSDNQPSTEKAMEPTMKFSLASVLRPLQEESIMEKDYSASINSLLERYDTYRDILEHHLQNNKFRITSDFSSEEDRSSSCLQAKLTDLQVIKNETDARWKEFEIISLKLENHVNDIKKPFVIKERDTLKERERELQMTLNTRMESLETALRLVLPVEKASLLLCGSDLPLHKMAIQGFHLIDADRIYQHLRNIQDSIAKQIEICNRLEEPGNFVLKELHPFDLHAMQNIILKYKTQFEGMNHRVQRSEDTLKALEDFLASLRTAKLSAEPVTDLSASDTQVAQENTLTVKNKEGEIHLMKDKAKHLDKCLKMLDMSFKDAERGDDTSCENLLDAFSIKLSETHGYGVQEEFTEENKLLEACIFKNNELLKNIQDVQSQISKIGLKDPTVPAVKHRKKSLIRLDKVLDEYEEEKRHLQEMANSLPHFKDGREKTVNQQCQNTVVLWENTKALVTECLEQCGRVLELLKQYQNFKSILTTLIQKEESVISLQASYMGKENLKKRIAEIEIVKEEFNEHLEVVDKINQVCKNLQFYLNKMKTFEEPPFEKEANIIVDRWLDINEKTEDYYENLGRALALWDKLFNLKNVIDEWTEKALQKMELHQLTEEDRERLKEELQVHEQKTSEFSRRVAEIQFLLQSSEIPLELQVMESSILNKMEHVQKCLTGESNCHALSGSTAELREDLDQAKTQIGMTESLLKALSPSDSLEIFTKLEEIQQQILQQKHSMILLENQIGCLTPELSELKKQYESVSDLFNTKKSVLQDHFSKLLNDQCKNFNDWFSNIKVNLKECFESSETKKSVEQKLQKLSDFLTLEGRNSKIKQVDSVLKHVKKHLPKAHVKELISWLVGQEFELEKMESICQARAKELEDSLQQLLRLQDDHRNLRKWLTNQEEKWKGMEEPGEKTELFCQALARKREQFESVAQLNNSLKEYGFTEEEEIIMEATCLMDRYQTLLRQLSEIEEEDKLLPTEDQSFNDLAHDVIHWIKEIKESLMVLNSSEGKMPLEERIQKIKEIILLKPEGDARIETIMKQAESSEAPLVQKTLTDISNQWDNTLHLASTYLSHQEKLLLEGEKYLQSKEDLRLMLIELKKKQEAGFALQHGLQEKKAQLKIYKKFLKKAQDLTSLLKELKSQGNYLLECTKNPSFSEEPWLEIKHLHESLLQQLQDSVQNLDGHVREHDSYQVCVTDLNTTLDNFSKEFVSFSDKPVDQIAVEEKLQKLQELENRLSLQDGTLKKILALAKSVKQNTSSVGQKIIKDDIKSLQCKQKDLENRLASAKQEMECCLNSILKSKRSTEKKGKFTLPGREKQATSDVQESTQESAAVEKLEEDWEINKDSAVEMAMSKQLSLNAQESMKNTEDERKVNELQNQPLELDTMLRNEQLEEIEKLYTQLEAKKAAIKPLEQTECLNKTETGALVLHNIGYSAQHLDNLLQALITLKKNKESQYCVLRDFQEYLAAVESSMKALLTDKESLKVGPLDSVTYLDKIKKFIASIEKEKDSLGNLKIKWENLSNHVTDMDKKLLESQIKQLEHGWEQVEQQIQKKYSQQVVEYDEFTTLMNKVQDTEISLQQQQQHLQLRLKSPEERAGNQSMIALTTDLQATKHGFSVLKGQAELQMKRIWGEKEKKNLEDGINNLKKQWETLEPLHLEAENQIKKCDIRNKMKETILWAKNLLGELNPSIPLLPDDILSQIRKCKVTHDGILARQQSVESLAEEVKDKVPSLTTYEGSDLNNTLEDLRNQYQMLVLKSTQRSQQLEFKLEERSNFFAIIRKFQLMVQESETLIIPRVETAATEAELKHHHVTLEASQKELQEIDSGISTHLQELTNIYEELNVFERLFLEDQLKNLKIRTNRIQRFIQNTCNEVEHKIKFCRQFHEKTSALQEEADSIQRNELLLNQEVNKGVKEEIYNLKDRLTAIKCCILQVLKLKKVFDYIGLNWDFSQLDQLQTQVFEKEKELEEKIKQLDTFEEEHGKYQALLSKMRAIDLQIKKMTEVVLKAPDSSPESRRLNAQILSQRIEKAKCLCDEIIKKLNENKTFDDSFKEKEILQIKLNAEENDKLYKVLQNMVLELSPKELDEKNCQDKLETSLHVLNQIKSQLQQPLLINLEIKHIQNEKDNCEAFQEQVWAEMCSIKAVTAIEKQREENSSEASDVETKLREFEDLQMQLNTSIDLRTNVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYRVDVGNPEESLEMPLRKQEELESTVAHIQDLTEKLGMISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETEAERYLENYKCYRKMEEDIYTNLSKMETVLGQSMSSLPLSYREALERLEQSKALVSNLISTKEELMKLRQILRLLRLRCTENDGICLLKIVSALWEKWLSLLEAAKEWEMWCEELKQEWKFVSEEIEREAIILDNLQEELPEISKTKEAATTEELSELLDCLCQYGENVEKQQLLLTLLLQRIRSIQNVPESSGAVETVPAFQEITSMKERCNKLLQKVQKNKELVQTEIQERHSFTKEIIALKNFFQQTTTSFQNMAFQDHPEKSEQFEELQSILKKGKLTFENIMEKLRIKYSEMYTIVPAEIESQVEECRKALEDIDEKISNEVLKSSPSYAMRRKIEEINNGLHNVEKMLQQKSKNIEKAQEIQKKMWDELDLWHSKLNELDSEVQDIVEQDPGQAQEWMDNLMIPFQQYQQVSQRAECRTSQLNKATVKMEEYSDLLKSTEAWIENTSHLLANPADYDSLRTLSHHASTVQMALEDSEQKHNLLHSIFMDLEDLSIIFETDELTQSIQELSNQVTALQQKIMESLPQIQRMADDVVAIESEVKSMEKRVSKIKTILLSKEIFDFSPEEHLKHGEVILENIRPMKKTIAEIVSYQVELRLPQTGMKPLPVFQRTNQLLQDIKLLENVTQEQNELLKVVIKQTNEWDEEIENLKQILNNYSAQFSLEHMSPDQADKLPQLQGEIERMEKQILSLNQRKEDLLVDLKATVLNLHQHLKQEQEGVERDRLPAVTSEEGGVAERDASERKLNRRGSMSYLAAVEEEVEESSVKSDNGDEKAEPSPQSWSSLWKHDKDMEEDRASSSSGTIVQEAYGKISTSDNSMAQILTPDSLNTEQGPECSLRPNQTEEGTTPPIEADTLDSSDAQGGLEPRVEKTRPEPTEVLHACKTQVAELELWLQQANVAVEPETLNADMQQVLEQQLVGCQAMLTEIEHKVAFLLETCKDQGLGDNGATQHEAEALSLKLKTVKCNLEKVQMMLQEKHSEDQHPTILKKSSEPEHQEALQPVNLSELESIVTERPQFSRQKDFQQQQVLELKPMEQKDFIKFIEFNAKKMWPQYCQHDNDTTQESSASNQASSPENDVPDSILSPQGQNGDKWQYLHHELSSKIKLPLPQLVEPQVSTNMGILPSVTMYNFRYPTTEELKTYTTQLEDLRQEASNLQTQENMTEEAYINLDKKLFELFLTLSQCLSSVEEMLEMPRLYREDGSGQQVHYETLALELKKLYLALSDKKGDLLKAMTWPGENTNLLLECFDNLQVCLEHTQAAAVCRSKSLKAGLDYNRSYQNEIKRLYHQLIKSKTSLQQSLNEISGQSVAEQLQKADAYTVELENAESRVAKLRDEGERLHLPYALLQEVYKLEDVLDSMWGMLRARYTELSSPFVTESQQDALLQGMVELVKIGKEKLAHGHLKQTKSKVALQAQIENHKVFFQKLVADMLLIQAYSAKILPSLLQNRETFWAEQVTEVKILEEKSRQCGMKLQSLLQKWEEFDENYASLEKDLEILISTLPSVSLVEETEERLVERISFYQQIKRNIGGKHARLYQTLNEGKQLVASVSCPELEGQIAKLEEQWLSLNKKIDHELHRLQALLKHLLSYNRDSDQLTKWLESSQHTLNYWKEQSLNVSQDLDTIRSNINNFFEFSKEVDEKSSLKTAVISIGNQLLHLKETDTATLRASLAQFEQKWTMLITQLPDIQEKLHQLQMEKLPSRKAITEMISWMNNVEHQTSDEDSVHSPSSASQVKHLLQKHKEFRMEMDYKQWIVDFVNQSLLQLSTCDVESKRYERTEFAEHLGEMNRQWHRVHGMLNRKIQHLEQLLESITESENKIQILNNWLEAQEERLKTLQKPESVISVQKLLLDCQDIENQLAIKSKALDELKQSYLTLESGAVPLLEDTASRIDELFQKRSSVLTQVNQLKTSMQSVLQEWKIYDQLYDEVNMMTIRFWYCMEHSKPVVLSLETLRCQVENLQSLQDEAESSEGSWEKLQEVIGKLKGLCPSVAEIIEEKCQNTHKRWTQVNQAIADQLQKAQSLLQLWKAYSNAHGEAAARLKQQEAKFQQLANISMSGNNLAEILPPALQDIKELQHDVQKTKEAFLQNSSVLDRLPQPAESSTHMLLPGPLHSLQRAAYLEKMLLVKANEFEFVLSQFKDFGVRLESLKGLIMHEEENLDRLHQQEKENPDSFLNHVLALTAQSPDIEHLNEVSLKLPLSDVAVKTLQNMNRQWIRATATALERCSELQGIGLNEKFLYCCEKWIQLLEKIEEALKVDVANSLPELLEQQKTYKMLEAEVSINQTIADSYVTQSLQLLDTTEIENRPEFITEFSKLTDRWQNAVQGVRQRKGDVDGLVRQWQDFTTSVENLFRFLTDTSHLLSAVKGQERFSLYQTRSLIHELKNKEIHFQRRRTTCALTLEAGEKLLLTTDLKTKESVGRRISQLQDSWKDMEPQLAEMIKQFQSTVETWDQCEKKIKELKSRLQVLKAQSEDPLPELHEDLHNEKELIKELEQSLASWTQNLKELQTMKADLTRHVLVEDVMVLKEQIEHLHRQWEDLCLRVAIRKQEIEDRLNTWVVFNEKNKELCAWLVQMENKVLQTADISIEEMIEKLQKDCMEEINLFSENKLQLKQMGDQLIKASNKSRAAEIDDKLNKINDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDDQEIQKRLAEQQDLQRDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMKIEETWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTSAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASRLKQMVHEGNQRWDNLQRRVTAVLRRLRHFTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESDADDKMRQLNGFQQEITLNTNKIDQLIVFGEQLIQKSEPLDAVLIEDELEELHRYCQEVFGRVSRFHRRLTSCTPGLEDEKEASENETDMEDPREIQTDSWRKRGESEEPSSPQSLCHLVAPGHERSGCETPVSVDSIPLEWDHTGDVGGSSSHEEDEEGPYYSALSGKSISDGHSWHVPDSPSCPEHHYKQMEGDRNVPPVPPASSTPYKPPYGKLLLPPGTDGGKEGPRVLNGNPQQEDGGLAGITEQQSGAFDRWEMIQAQELHNKLKIKQNLQQLNSDISAITTWLKKTEAELEMLKMAKPPSDIQEIELRVKRLQEILKAFDTYKALVVSVNVSSKEFLQTESPESTELQSRLRQLSLLWEAAQGAVDSWRGGLRQSLMQCQDFHQLSQNLLLWLASAKNRRQKAHVTDPKADPRALLECRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRAKQFRAVRTTEGEEETESRVPGSTRPQRSFLSRVVRAALPLQLLLLLLLLLACLLPSSEEDYSCTQANNFARSFYPMLRYTNGPPPT nlrc4_mouse NLR family CARD domain-containing protein 4 Nlrc4 Card12 Ipaf Caspase recruitment domain-containing protein 12 Ice protease-activating factor protein protein mouse Mus musculus Mouse MNFIRNNRRALIQRMGLTVTKQICDDLFALNVLNNQEANVIYCEPLEQEAARKIIHMTMQKGSAACNLFLKSLENWDYFVYQDLTGQNLSYQVTEEDLNVLAQNLKDLYNSPAFLNFYPLGEDIDIIFNLEKTFTEPIMWKKDHRHHRVEQLTLGSLLEALKSPCLIEGESGKGKSTLLQRIAMLWASGGCRALKGFRLVFFIHLRSARGGLFETLYDQLLNIPDFISKPTFKALLLKLHKEVLFLLDGYNEFHPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRHVGALTAEVGDMTEDSAKDLIEAVLVPDQVERLWAQIQESRCLRNLMKTPLFVVITCAIQMGRQEFQAHTQTMLFQTFYDLLIQKNSHRYRGGASGDFARSLDYCGDLALEGVFAHKFDFEPEHGSSMNEDVLVTIGLLCKYTAQRLKPTYKFFHKSFQEYTAGRRLSSLLTSKEPEEVSKGNSYLNKMVSISDITSLYGNLLLYTCGSSTEATRAVMRHLAMVYQHGSLQGLSVTKRPLWRQESIQSLRNTTEQDVLKAINVNSFVECGINLFSESMSKSDLSQEFEAFFQGKSLYINSENIPDYLFDFFEYLPNCASALDFVKLDFYERATESQDKAEENVPGVHTEGPSETYIPPRAVSLFFNWKQEFKTLEVTLRDINKLNKQDIKYLGKIFSSATNLRLHIKRCAAMAGRLSSVLRTCKNMHTLMVEASPLTTDDEQYITSVTGLQNLSIHRLHTQQLPGGLIDSLGNLKNLERLILDDIRMNEEDAKNLAEGLRSLKKMRLLHLTHLSDIGEGMDYIVKSLSEESCDLQEMKLVACCLTANSVKVLAQNLHNLIKLSILDISENYLEKDGNEALQELIGRLGVLGELTTLMLPWCWDVHTSLPKLLKQLEGTPGLAKLGLKNWRLRDEEIKSLGEFLEMNPLRDLQQLDLAGHCVSSDGWLYFMNVFENLKQLVFFDFSTEEFLPDAALVRKLSQVLSKLTLLQEVKLTGWEFDDYDISAIKGTFKLVTA bir1b_mouse Baculoviral IAP repeat-containing protein 1b Naip2 Birc1b Naip-rs6 Neuronal apoptosis inhibitory protein 2 protein protein mouse Mus musculus Mouse MAAQGEAVEEIICEFDDDLVSELSTLLRVDALSVLKRQQEEDHKTRMKMKKGFNSQMRSEAKRLKTFETYDKFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLILFSTRLRKLPIENHKKLRPECEFLLGKDVGNIGKYDIRVKSPEKMLRGDKARYHEEEARLESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLQSKKSPEEITQYVQSYEGFLHVTGEHFVNSWVRRELPMVSAYCNDSVFANEELRMDTFKDWPHESPGAVEALVKAGLFYTGKRDIVQCFSCGGCMEKWAEGDNPIEDHTKFFPNCVFLQTLKSSAEVIPALQSHCALPEAMETTSESNHDDAAAVHSTVVDVSPSEAQELEPASSLVSVLCRDQDHSEAQGRGCASSGTYLPSTDLGQSEAQWLQEARSLSEQLRDTYTKATFRHMNLPEVYSSLGTDHLLSCDVSIISKHISQPVQGSLTIPEVFSNLNSVMCVEGEAGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPGQELAKIICAQLLGAGGCISEVCLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNKVRGIRPYLDTSLEIKEFPFYNTVSVLRKLFSHDIMRVRKFINYFGFHEELQGIHKTPLFVAAVCTDWFKNPSDQPFQDVALFKAYMQYLSLKHKGAAKPLQATVSSCGQLALTGLFSSCFEFNSDNLAEAGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQDLGLYYLRQINSPLKAMSIYHTFLKYVSSHPSSKAAPTVVSHLLQLVDEKESLENMSENEDYMKLHPEALLWIECLRGLWQLSPESFSLFISENLLRICLNFAHESNTVAACSPVILQFLRGRTLDLKVLSLQYFWDHPETLLLLKSIKISLNGNNWVQRIDFSLIEKSFEKVQPPTIDQDYAIAFQPINEVQKNLSEKKHIIKKYEDMKHQIPLNISTGYWKLSPKPYKIPKLEVQVTNTGPADQALLQVLMEVFSASQSIEFRLSDSSGFLESIRPALELSKASVTKCSMSRLELSREDQKLLLTLPTLQSLEVSETNQLPDQLFHNLHKFLGLKELCVRLDSKPDVLSVLPGEFPNLHHMEKLSIRTSTESDLSKLVKLIQNSPNLHVFHLKCNFLSNCEPLMTVLASCKKLREIEFSGRCFEAMTFVNILPNFVFLKILNLRDQQFPDKETSEKFAQALGSLRNLEKLFVPTGDGIHQVAKLIVRQCLQLPCLRVLVFAETLDDDSVLEIAKGATRGGFQKLENLDLTLNHKITEEGYRNFFQVLDNLPNLKNLDISRHIPECIQIQAITVKALGQCVSRLPSLTRLGMLSWLLDEEDIKVINDVKERHPQSKRLTVHWRWVVPFSPVIQK bir1e_mouse Baculoviral IAP repeat-containing protein 1e Naip5 Birc1e Naip-rs3 Neuronal apoptosis inhibitory protein 5 protein protein mouse Mus musculus Mouse MAEHGESSEDRISEIDYEFLPELSALLGVDAFQVAKSQEEEEHKERMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQEMAAAGFYHTGVRLGVQCFCCSLILFGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKRPEKMLRGGKARYHEEEARLESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSEEIAQYIQSYEGFVHVTGEHFVKSWVRRELPMVSAYCNDSVFANEELRMDMFKDWPQESPVGVEALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQTLKSSAEVIPTLQSQYALPEATETTRESNHGDAAAVHSTVVDLGRSEAQWFQEARSLSEQLRDNYTKATFRHMNLPEVCSSLGTDHLLSCDVSIISKHISQPVQEALTIPEVFSNLNSVMCVEGETGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLANIICAQLLGAGGCISEVCLSSSIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNRVRDIRLYLGTSLEIQEFPFYNTVSVLRKFFSHDIICVEKLIIYFIDNKDLQGVYKTPLFVAAVCTDWIQNASAQDKFQDVTLFQSYMQYLSLKYKATAEPLQATVSSCGQLALTGLFSSCFEFNSDDLAEAGVDEDEKLTTLLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQDLGLYYLRQIDSPLKAINSFNIFLYYVSSHSSSKAAPTVVSHLLQLVDEKESLENMSENEDYMKLHPQTFLWFQFVRGLWLVSPESSSSFVSEHLLRLALIFAYESNTVAECSPFILQFLRGKTLALRVLNLQYFRDHPESLLLLRSLKVSINGNKMSSYVDYSFKTYFENLQPPAIDEEYTSAFEHISEWRRNFAQDEEIIKNYENIRPRALPDISEGYWKLSPKPCKIPKLEVQVNNTDAADQALLQVLMEVFSASQSIEFRLFNSSGFLESICPALELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPEQLFHNLHKFLGLKELCVRLDGKPNVLSVLPREFPNLLHMEKLSIQTSTESDLSKLVKFIQNFPNLHVFHLKCDFLSNCESLMAVLASCKKLREIEFSGRCFEAMTFVNILPNFVSLKILNLKDQQFPDKETSEKFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLTFHDILDDDSVIEIARAATSGGFQKLENLDISMNHKITEEGYRNFFQALDNLPNLQELNICRNIPGRIQVQATTVKALGQCVSRLPSLIRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKLIVPFSPVILE q5zvv0_legph Flagellin fliC lpg1340 protein protein legph Legionella pneumophila subsp. pneumophila MAQVINTNVASLTAQRNLGVSGNMMQTSIQRLSSGLRINSAKDDAAGLAISQRMTAQIRGMNQAVRNANDGISLAQVAEGAMQETTNILQRMRELSVQAANSTNNSSDRSSIQSEISQLKSELERIAQNTEFNGQRILDGSFSGASFQVGANSNQTINFSIGSTKASSLGGIATATGTEVAGAAAADITIAIGGGAATSINSSANFTGALNGQDATSAYAKAAAINDAGIGGLSVTASTSGTQAVGAIGGTAGDTYNLTINGVAIYTNLNVATALTNSDLRDAINGVSNQTGVVASLNGGNMTLTAADGRNITVTESGTGFTAGTDGLTVTGGAFDGALRGTLSISAVDTIAIGGTVANIGLSANISKDTVGIDSLDVSTASGAQTAIKRIDAALNSVNSNRANMGALQNRFESTIANLQNVSDNLSAARSRIQDADYAAEMASLTKNQILQQAGTAMLAQANSLPQSVLSLLGR bir1f_mouse Baculoviral IAP repeat-containing protein 1f Naip6 Birc1f Naip-rs4 Neuronal apoptosis inhibitory protein 6 protein protein mouse Mus musculus Mouse MAEHGESSEDRISEIDYEFLAELSARFGMNLVQLAKSQEEEDHKERMKMKKGFNSQMRSEAKRLKTFESYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLILFGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKSPEKMLRGGKARYHEEEARLESFEDWPFYAHGTSPRALSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSEEIAQYIQDYEGFVHVTGEHFVKSWVRRELPMVSAYCNDSVFTNEELRMDMFKDWPQESPVGFEALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQTLKSSAEVIPTLQSQYALPEATETTRESNHDDAAAVHSTVVDLGRSEAQWFQEARSLSEQLRDTYTKTSFCHMNLPEVCSSLGTDHLLGCDVSIISKHVSQPVQGALTIPEVFSNLSSVMCVEGEAGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLANIICTQLLGAGGCISEVCLSSSIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLFRTCLLIAVHTNRVRDIRPYLGTSLEIQEFPFYNTVFVLRKFFSHDIICVEKLIIYFSENKDLQGVYKTPLFVAAVCNDWNQNASAQDDFQDVTLFHSYMQYLSLKYKATAESLQATVSSCGQLALTGLFSSCFEFNSDDLAEAGVDEDVKLTTFLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQDLGLYYLRQIDSPLKAINSFNIFLYYVSSHSSSKAAPTVVSHLLQLVDEKESLENMSENEDYMKLHPQTFLWFQFVRGLWLVSPESFSSFVSEHLLRLALIFAYESNTVAECSPFILQFLRGRTLALRVLNLEYFWDHPESLLLLRSLKVSINGNKMSSYVDYSFKTYFENLQPPAINEEYTSAFEHVSEWRRNFAQDEEIIKNYENIWPRALPDISEGYWNLSPKPCKIPKLEVQVNNMGPADQALLQVLMEVFSASQSIEFHLFNSSGFLESIRPALELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPDQLFHNLHKFLGLKELCVRLDGKPDVLSVLPEEFLNLHHMEKLSIRTSTESDLSKLVKFIQNFPNLHVFHLKCDFLSNCESLMTALASCKKLREIEFSGQCFEAMTFVNILPNFVSLKILSLKGQQFADKETSEKFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLAFHDILDDESVIEIARAATSGSFQKLENLDISMNHKITEEGYRNFFQALDNLPNLQMLNICRNIPGRIQVQATTVKALGHCVSRLPSLTRLGMLSWLLDEEDMKVINDVKERHPQSKRLTIFWKWIVPFSPVVLE prgj_salty Protein PrgJ prgJ STM2872 protein protein salty Salmonella typhimurium MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS 7AC04EF792D72598 lubx-icmw-1 3230378 N/A 3230394 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3230395 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false eef1a1-q5zvs2_legph-1 3149665 N/A 3149667 enzyme target enzyme target substrate substrate unspecified role unspecified role P68104:p.Ser53Thr S53T mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P68104:p.Ser53Ala S53A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3149668 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli glycosylation glycosylation reaction glycosylation false false false eef1a2-q5zvs2_legph-1 3149666 N/A 3149669 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3149668 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli glycosylation glycosylation reaction glycosylation false false false atp6v1a-atp6v1b2-3 3723715 N/A 3723717 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 3723718 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723719 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723720 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723721 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723722 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723723 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723724 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 physical association physical association false false false Fig 1c atp6v1a-q5zww6_legph-1 3723715 N/A 3723717 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3723724 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 physical association physical association false false false Fig 1c atp6v1a-atp6v1b2-1 3723715 N/A 3723717 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 3723718 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723719 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723720 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 2.0 N/A 3723721 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723722 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723723 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723724 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 physical association physical association false false false Fig 1c atp6v1a-atp6v1b2-2 3723715 N/A 3723717 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 3723718 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723719 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723721 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723722 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723723 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723724 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 physical association physical association false false false Fig 1c atp6ap1-atp6ap2-1 3723716 N/A 3723725 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723726 structure determination identification by structure determination identification by structure determination structure determination monoclonal immunost monoclonal antibody immunostaining monoclonal immunost unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 16.0 N/A 3723727 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723728 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723729 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723730 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723731 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723732 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723717 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 3723718 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723719 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723720 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723721 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723722 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723723 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723724 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 physical association physical association false false false Fig 1d, Fig S3 lubx-sidh-1 3280458 N/A 3280461 unspecified role unspecified role prey prey legph Legionella pneumophila subsp. pneumophila N/A 3230395 unspecified role unspecified role bait bait Region 1-221 Region 1-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q5ZRQ0:p.Arg121Glu R121E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q5ZRQ0:p.Arg121Ala R121A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false naip5-flic-4 3450997 N/A 3450999 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451000 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaC35 FlaC35 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mCherry mCherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Fig S7A naip5-flic-1 3450997 N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaN65 FlaN65 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q5ZVV0:p.Arg31_Ser33delinsAlaAlaAla 31-33A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 3450999 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3451000 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R016:p.Phe32_Val34delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Gln837_Thr838delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Phe839_Leu840delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig2B Mutation Asn107Ala;Ser108Ala decreased the ability of NAIP5 to bind flagellin proteins but had no effect on interaction with NLRC4 Mutation Trp841Ala;Phe842Ala decreased the ability of NAIP5 to bind the N-65 flagellin protein but had no effect on interaction with the C-35 protein or NLRC4 Mutation Gln843Ala;Phe844Ala decreased the ability of NAIP5 to bind the N-65 and C-35 flagellin proteins but had no effect on interaction with NLRC4 Mutation Leu848Ala;Trp849Ala decreased the ability of NAIP5 to bind flagellin proteins but had no effect on interaction with NLRC4 flic-flic-1 3450997 N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false FlaN65 FlaN65 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451000 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Supp Fig 7B naip5-flic-2 3450997 N/A 3450999 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451000 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q5ZVV0:p.[Leu470Ala;Leu472Ala;Leu473Ala] p.Arg31Ala,Leu32Ala,Ser33Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Supp Fig 9A naip5-flic-3 3450997 N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false FlaN65 FlaN65 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5ZVV0:p.[Arg31Ala;Leu32Ala;Ser33Ala] p.Arg31Ala,Leu32Ala,Ser33Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451000 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q5ZVV0:p.[Leu470Ala;Leu472Ala;Leu473Ala] p.Leu470Ala,Leu472Ala,Leu473Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Supp. Fig 9A naip5-nlrc4-3 3450997 N/A 3450999 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451000 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R016:p.Gly847Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Tyr974_Glu975delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Ile626_Ile627delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig 2F naip6-flic-1 3450997 N/A 3451002 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain false FlaN65-FlaC35 Fla440-475 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Fig S9B naip6-flic-2 3450997 N/A 3451002 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaN65 Fla1-65 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false FlaC35 Fla441-475 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q5ZVV0:p.[Leu470Ala;Leu472Ala;Leu473Ala] p.Leu470Ala,Leu472Ala,Leu473Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Fig S9B naip2-nlrc4-6 3450997 N/A 3451003 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed PrgJN63-C35 PrgJN63-C35 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451004 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Fig S9C naip2-nlrc4-7 3450997 N/A 3451003 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mCherry mCherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false PrgJC38 PrgJC38 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false p.Leu98_Ser101del PrgJC38_dC4 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451003 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed PrgJN63 PrgJN63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P41785:p.[Leu33Ala;Leu34Ala] p.Leu33Ala,Leu34Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451004 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Fig S9C nlrc4-naip2-1 3450997 N/A 3451003 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mCherry mCherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false PrgJC38 PrgJC38 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451003 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed PrgJN63 PrgJN63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451004 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Fig S9D prgj-naip2-1 3450997 N/A 3451003 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false PrgJN63 PrgJN63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451004 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451003 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mCherry mCherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false PrgJC38 PrgJC38 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Fig S9D naip5-flic-6 3450997 N/A 3450999 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451000 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R016:p.Gln837_Thr838delinsAlaAla Q837A/T838A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Phe839_Leu840delinsAlaAla F839A/L840A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Trp841_Phe842delinsAlaAla W841A/F842A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Gln843_Phe844delinsAlaAla Q843A/F844A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Gly847Lys G847K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Leu848_Trp849delinsAlaAla L848A/W849A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Cys1329_Arg1330delinsAlaAla C1329A/R1330A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9R016:p.[His1360Ala;Leu1362_Ser1363delinsAlaAla] H1360A/L1362A/S1363A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Tyr974_Glu975delinsAlaAla Y974A/E975A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9R016:p.Ile626_Ile627delinsAlaAla I626A/I627A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Fig 2F naip5-nlrc4-4 3450997 N/A 3450999 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q3UP24:p.Asp125Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q3UP24:p.Ile127Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q3UP24:p.Met349Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q3UP24:p.Asn116Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q3UP24:p.Tyr118Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q3UP24:p.[Phe79Ala;Asp83Ala;Arg288Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q3UP24:p.Ile124Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q3UP24:p.Leu120Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q3UP24:p.Asp123Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451000 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Supp Fig 5B naip5-flic-7 3450997 N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q5ZVV0:p.Leu12Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false FlaN65 FlaN65 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5ZVV0:p.Leu18Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q5ZVV0:p.Met25Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q5ZVV0:p.Leu32Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FlaC35 FlaC35 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GFP tag GFP tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451000 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Supp Fig 7A flic-naip5-8 3450998 N/A 3451000 unspecified role unspecified role neutral component neutral component purified purified FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3451001 unspecified role unspecified role neutral component neutral component purified purified 6myc-tag 6myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3450999 unspecified role unspecified role neutral component neutral component purified purified GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q3UP24:p.[Phe79Ala;Asp83Ala] p.Phe79Ala,Asp83Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig 1 q5zwz3_legph-rab1b-1 3231562 N/A 3231570 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab8a-1 3231563 N/A 3231572 unspecified role unspecified role unspecified role unspecified role Region 6-176 Region 6-176 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab8a-2 3231564 N/A 3231572 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab6a-1 3231565 N/A 3231573 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab8a-3 3231566 N/A 3231572 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab1b-2 3231567 N/A 3231570 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab6a-2 3231568 N/A 3231573 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab1b-3 3231569 N/A 3231570 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bcl2l13-sidf-1 3153554 N/A 3153572 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3153573 unspecified role unspecified role prey prey Region 762-912 Region 762-912 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false sidf-bnip3-1 3153555 N/A 3153574 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait Region 650-912 Region 650-912 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sidf-bcl2l13-1 3153556 N/A 3153572 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sidf-podxl-1 3153557 N/A 3153575 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sidf-bnip3-2 3153558 N/A 3153574 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sidf-fkbp8-1 3153559 N/A 3153576 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false bcl2l13-sidf-2 3153560 N/A 3153572 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3153573 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false sidf-vapa-1 3153561 N/A 3153577 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sidf-bcl2l13-2 3153562 N/A 3153572 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3153573 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false sidf-tmub2-1 3153563 N/A 3153578 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sidf-hmox2-1 3153564 N/A 3153579 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sidf-acbd3-1 3153565 N/A 3153580 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false bcl2l13-sidf-3 3153566 N/A 3153572 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3153573 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false sidf-aqp1-1 3153567 N/A 3153581 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sidf-bcl2l13-3 3153568 N/A 3153572 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3153573 unspecified role unspecified role bait bait Region 751-912 Region 751-912 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false sidf-bnip3-3 3153569 N/A 3153574 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3153573 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false sidf-syne2-1 3153570 N/A 3153582 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sidf-bcl2l13-4 3153571 N/A 3153572 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3153573 unspecified role unspecified role bait bait Region 650-912 Region 650-912 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false legk1-nfkb2-1 3195000 N/A 3195003 enzyme target enzyme target substrate substrate unspecified role unspecified role C-terminal domain Region 755-900 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3195004 enzyme enzyme unspecified role unspecified role Region 1-386 Region 1-386 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false legk1-nfkbia-1 3195002 N/A 3195008 enzyme target enzyme target substrate substrate unspecified role unspecified role pS32 pS32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3195004 enzyme enzyme unspecified role unspecified role Region 1-386 Region 1-386 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false icmr-icmq-1 3294643 N/A 3294646 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3294647 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false icmq-icmr-4 3294644 N/A 3294646 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294647 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false icmq-icmr-5 3294645 N/A 3294646 unspecified role unspecified role unspecified role unspecified role Region 28-86 Region 28-86 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294647 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mpidb The Microbial Protein Interaction Database chatterjee-2012-1 Structural characterization of a conserved, calcium-dependent periplasmic protease from Legionella pneumophila. ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Chatterjee D., Boyd C.D., O'Toole G.A., Sondermann H. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation chatterjee-2012-2 Structural characterization of a conserved, calcium-dependent periplasmic protease from Legionella pneumophila. ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chatterjee D., Boyd C.D., O'Toole G.A., Sondermann H. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation kubori-2008-1 Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kubori T., Hyakutake A., Nagai H. Mouse liver cDNA Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation kubori-2008-2 Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kubori T., Hyakutake A., Nagai H. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation kubori-2008-3 Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kubori T., Hyakutake A., Nagai H. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation neunuebel-2012-1 Legionella pneumophila LidA affects nucleotide binding and activity of the host GTPase Rab1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Neunuebel M.R., Mohammadi S., Jarnik M., Machner M.P. Origin of RAB1A taken from PMID: 16824952 as referenced in the text. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation clk1_mouse Dual specificity protein kinase CLK1 Clk1 Clk Sty CDC-like kinase 1 Protein kinase STY protein protein mouse Mus musculus Mouse MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESRSINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRHHTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFRCVQMLEWFEHRGHICIVFELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKRRYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEALKHPFFYPLKKHT lubx_legph E3 ubiquitin-protein ligase LubX Legionella U-box protein lubX legU2 lpg2830 RING-type E3 ubiquitin transferase LubX protein protein legph Legionella pneumophila subsp. pneumophila MGYRIEMATRNPFDIDHKSKYLREAALEANLSHPETTPTMLTCPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKDLQPFPELLIIVNRFVETQTNYEKLKNRLVQNARVAARQKEYTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQQIKVYNFYRKREMQKNQIQPSVSSGFGFFSLNFLTSWLWGTEEKKEKTSSDMTY gogb1_human Golgin subfamily B member 1 Giantin Macrogolgin 372 kDa Golgi complex-associated protein GOLGB1 protein protein human Homo sapiens Human MLSRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLNKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKEELISTLQAQLTQAQAEQPAQSSTEMEEFVMMKQQLQEKEEFISTLQAQLSQTQAEQAAQQVVREKDARFETQVRLHEDELLQLVTQADVETEMQQKLRVLQRKLEEHEESLVGRAQVVDLLQQELTAAEQRNQILSQQLQQMEAEHNTLRNTVETEREESKILLEKMELEVAERKLSFHNLQEEMHHLLEQFEQAGQAQAELESRYSALEQKHKAEMEEKTSHILSLQKTGQELQSACDALKDQNSKLLQDKNEQAVQSAQTIQQLEDQLQQKSKEISQFLNRLPLQQHETASQTSFPDVYNEGTQAVTEENIASLQKRVVELENEKGALLLSSIELEELKAENEKLSSQITLLEAQNRTGEADREVSEISIVDIANKRSSSAEESGQDVLENTFSQKHKELSVLLLEMKEAQEEIAFLKLQLQGKRAEEADHEVLDQKEMKQMEGEGIAPIKMKVFLEDTGQDFPLMPNEESSLPAVEKEQASTEHQSRTSEEISLNDAGVELKSTKQDGDKSLSAVPDIGQCHQDELERLKSQILELELNFHKAQEIYEKNLDEKAKEISNLNQLIEEFKKNADNNSSAFTALSEERDQLLSQVKELSMVTELRAQVKQLEMNLAEAERQRRLDYESQTAHDNLLTEQIHSLSIEAKSKDVKIEVLQNELDDVQLQFSEQSTLIRSLQSQLQNKESEVLEGAERVRHISSKVEELSQALSQKELEITKMDQLLLEKKRDVETLQQTIEEKDQQVTEISFSMTEKMVQLNEEKFSLGVEIKTLKEQLNLLSRAEEAKKEQVEEDNEVSSGLKQNYDEMSPAGQISKEELQHEFDLLKKENEQRKRKLQAALINRKELLQRVSRLEEELANLKDESKKEIPLSETERGEVEEDKENKEYSEKCVTSKCQEIEIYLKQTISEKEVELQHIRKDLEEKLAAEEQFQALVKQMNQTLQDKTNQIDLLQAEISENQAIIQKLITSNTDASDGDSVALVKETVVISPPCTGSSEHWKPELEEKILALEKEKEQLQKKLQEALTSRKAILKKAQEKERHLREELKQQKDDYNRLQEQFDEQSKENENIGDQLRQLQIQVRESIDGKLPSTDQQESCSSTPGLEEPLFKATEQHHTQPVLESNLCPDWPSHSEDASALQGGTSVAQIKAQLKEIEAEKVELELKVSSTTSELTKKSEEVFQLQEQINKQGLEIESLKTVSHEAEVHAESLQQKLESSQLQIAGLEHLRELQPKLDELQKLISKKEEDVSYLSGQLSEKEAALTKIQTEIIEQEDLIKALHTQLEMQAKEHDERIKQLQVELCEMKQKPEEIGEESRAKQQIQRKLQAALISRKEALKENKSLQEELSLARGTIERLTKSLADVESQVSAQNKEKDTVLGRLALLQEERDKLITEMDRSLLENQSLSSSCESLKLALEGLTEDKEKLVKEIESLKSSKIAESTEWQEKHKELQKEYEILLQSYENVSNEAERIQHVVEAVRQEKQELYGKLRSTEANKKETEKQLQEAEQEMEEMKEKMRKFAKSKQQKILELEEENDRLRAEVHPAGDTAKECMETLLSSNASMKEELERVKMEYETLSKKFQSLMSEKDSLSEEVQDLKHQIEGNVSKQANLEATEKHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELSRVTKLKETAEEEKDDLEERLMNQLAELNGSIGNYCQDVTDAQIKNELLESEMKNLKKCVSELEEEKQQLVKEKTKVESEIRKEYLEKIQGAQKEPGNKSHAKELQELLKEKQQEVKQLQKDCIRYQEKISALERTVKALEFVQTESQKDLEITKENLAQAVEHRKKAQAELASFKVLLDDTQSEAARVLADNLKLKKELQSNKESVKSQMKQKDEDLERRLEQAEEKHLKEKKNMQEKLDALRREKVHLEETIGEIQVTLNKKDKEVQQLQENLDSTVTQLAAFTKSMSSLQDDRDRVIDEAKKWERKFSDAIQSKEEEIRLKEDNCSVLKDQLRQMSIHMEELKINISRLEHDKQIWESKAQTEVQLQQKVCDTLQGENKELLSQLEETRHLYHSSQNELAKLESELKSLKDQLTDLSNSLEKCKEQKGNLEGIIRQQEADIQNSKFSYEQLETDLQASRELTSRLHEEINMKEQKIISLLSGKEEAIQVAIAELRQQHDKEIKELENLLSQEEEENIVLEEENKKAVDKTNQLMETLKTIKKENIQQKAQLDSFVKSMSSLQNDRDRIVGDYQQLEERHLSIILEKDQLIQEAAAENNKLKEEIRGLRSHMDDLNSENAKLDAELIQYREDLNQVITIKDSQQKQLLEVQLQQNKELENKYAKLEEKLKESEEANEDLRRSFNALQEEKQDLSKEIESLKVSISQLTRQVTALQEEGTLGLYHAQLKVKEEEVHRLSALFSSSQKRIAELEEELVCVQKEAAKKVGEIEDKLKKELKHLHHDAGIMRNETETAEERVAELARDLVEMEQKLLMVTKENKGLTAQIQSFGRSMSSLQNSRDHANEELDELKRKYDASLKELAQLKEQGLLNRERDALLSETAFSMNSTEENSLSHLEKLNQQLLSKDEQLLHLSSQLEDSYNQVQSFSKAMASLQNERDHLWNELEKFRKSEEGKQRSAAQPSTSPAEVQSLKKAMSSLQNDRDRLLKELKNLQQQYLQINQEITELHPLKAQLQEYQDKTKAFQIMQEELRQENLSWQHELHQLRMEKSSWEIHERRMKEQYLMAISDKDQQLSHLQNLIRELRSSSSQTQPLKVQYQRQASPETSASPDGSQNLVYETELLRTQLNDSLKEIHQKELRIQQLNSNFSQLLEEKNTLSIQLCDTSQSLRENQQHYGDLLNHCAVLEKQVQELQAGPLNIDVAPGAPQEKNGVHRKSDPEELREPQQSFSEAQQQLCNTRQEVNELRKLLEEERDQRVAAENALSVAEEQIRRLEHSEWDSSRTPIIGSCGTQEQALLIDLTSNSCRRTRSGVGWKRVLRSLCHSRTRVPLLAAIYFLMIHVLLILCFTGHL goga2_human Golgin subfamily A member 2 GOLGA2 130 kDa cis-Golgi matrix protein GM130 autoantigen Golgin-95 protein protein human Homo sapiens Human MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLELYKNTQSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQFSSRCEAPDANQQLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHTLREEKECSMSRVQELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLAGQLQAQVQDNEGLSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWHGRFLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTAQQIMQLLREMQNPRERPGLGSNPCIPFFYRADENDEVKITVI uso1_human General vesicular transport factor p115 USO1 VDP Protein USO1 homolog Transcytosis-associated protein Vesicle-docking protein protein protein human Homo sapiens Human MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQAMEHLIHVLQTDRSDSEIIGYALDTLYNIISNEEEEEVEENSTRQSEDLGSQFTEIFIKQQENVTLLLSLLEEFDFHVRWPGVKLLTSLLKQLGPQVQQIILVSPMGVSRLMDLLADSREVIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIISEEGNSDGGIVVEDCLILLQNLLKNNNSNQNFFKEGSYIQRMKPWFEVGDENSGWSAQKVTNLHLMLQLVRVLVSPTNPPGATSSCQKAMFQCGLLQQLCTILMATGVPADILTETINTVSEVIRGCQVNQDYFASVNAPSNPPRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNQKGQGEIVSTLLPSTIDATGNSVSAGQLLCGGLFSTDSLSNWCAAVALAHALQENATQKEQLLRVQLATSIGNPPVSLLQQCTNILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNSLESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTLEQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI rab1a_human Ras-related protein Rab-1A YPT1-related protein RAB1A RAB1 protein protein human Homo sapiens Human MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC q5zwz3_legph lpg0940 protein protein legph Legionella pneumophila subsp. pneumophila MAKDNKSHQVKTSEGSLESVKTKEKEPVLEKMRVEDSKKEDKLSMPTTKKESQPNEPVKPFKTSFEKWIESSLLDPQAKEDRGSTINLGREGLKNASQVKKFLLSPAGKDVIAELGAQMALQRNINLQNQQDRMEHELFKRRLMAALFLWYLSKKSHAAEKVKEIIREYNEKAIKNAEKASKPSQQSTSSTSQADKEIQKMLDEYEQAIKRAQENIKKGEELEKKLDKLERQGKDLEDKYKTYEENLEGFEKLLTDSEELSLSEINEKMEAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAHLAINKDQEVVEHEGQFYLLQKGQWDAIKNNPAALEKAQKDYSQSKHDLATIKMEALIHKLSLEMEKQLETINNLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVHRKEKSFFNEKGEEVTSLNDAHYVIGKDQQLFNLGGKFYPIHKEQKILEKDGKFYLLKQGEDWESIKDSPEKQKKAEHDFHKLQYETPMTVKKLVHHNKGLETTIHKERVEETKQQLEDNGKEKIEIANNISKLQSTVGVALNQLNQPTLDTESPVLTPSGGSTTSSPKPTPSLASVTTFFKTKIDEMKKNENVKVTFDDLLALSIKIADPKARTYFTGELLKEVPRSGAIPFQTMQRMLQTLEQYGVDTTKPSVTSIRSKTDEVLEQRFNPTPSLSPFKTS q3kk32_psepf lapF Pfl01_0130 protein protein psepf Pseudomonas fluorescens MFFAGLTFTIKRFLLCPGCLALAVRFAIPRIARWLACALLLAGIMLGGLHADWDFSAISRKATALYGPLGAGQQRIDAWQNLLATQKQVSEMEKLKVVNLFFNKQMRYVEDIDLWHEVDYWETPIEALWKGAGDCEDYAIAKYFSLRHLGVASDKLRITYVKALRQNRAHMVLTYYSSPDAMPLVLDSLIDPIKPAAERTDLLPVYSFNAEGLYLPGAKGNKKVGDTKRLSRWQDVLKKMQAEGFPVETTN q3kk31_psepf lapD Pfl01_0131 protein protein psepf Pseudomonas fluorescens MSLFKQLLIAICLFLVVAFTGSFMVSLESSRTQYVNQLRSHAQDAATALALSLTPNIDDPAMVELLVSSIFDSGYYSSIRVVDLKTDQTIVERNGIPAVTNVPDWFVKLIGLEPAGGDALVSRGWEQAARVEVVSHPMFALAKLWQSALGSLGWLLVCGAVSAVLGALLLRRQLKPLDYMVKQSHAIARREFLSLPDLPRTPELRRVVLAMNQMVEKLKALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDQSLVADVGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG q5zxa3_legph lpg0829 protein protein legph Legionella pneumophila subsp. pneumophila MTLTKKMAVGVLIMLLFVFIGTYFITMNNARNFFIQQLESNAQDTATSLGLSLSQSLINHDVPTMDSMVKAVFDRGYFSSIKVQDIKGKVIILKKQLPQESDIPQWFVNLIKWPSTEKSSLIMDGWMQAGVVLVASDPSYVYASLWRNAVEMVNAYLIFALVALVLSYGFLKYLLQPLKRVTAQALAISEHEFPVETKIPKTPELRQVTLAMNQMVTKVKSLFQDQLKQTESLRTQVYQDSLTGMSNRRYFLQHLALILDNEDEFIPGYVMMLVIDGLDELNQKQGYQQGDQLVLTVAKICKSYWKQSSVSTLARINGTTFALISHERDPLVFEKECQEFEQILSQGINDIKICKIHMGAASYFLHQPVSNLLSTVDQAVKKARETGVFYCQKEHDTYKYPQLISGDEIRNSLQQKKISLYAQAVTDGKNCFHKEVFVRIRNQEGEELGAGYFIPVAEKLGLAYPIDQYVLNELTVMDIATHTHFALNISEDTLANKVNSTGYLRQLEDTPAAVLRNLSLEINEAHVLSHFSNSKFFIKQAKKLGVTVGIDRVGIKFSPLHYLSDLNIDYLKLHGSLVTDIDENESKQFFIHYFNEMAKTMDIAVVATQVESEAQWQALQIVHIPWGQGRFLSSVELIK q5zxa4_legph lpg0828 protein protein legph Legionella pneumophila subsp. pneumophila MLKESWLLSKSRPRRLSVIAKRFQKVFLESLRYRLVLSIWTGLILCYVTSFSTQAAPLISVEKIQKLAQSYQGDTRKRFTAWGNLIDSLKKKPVKIQLEKVNSFFNQFNYETDPITGASDDYWKSPVEFIVDGGGDCEDFAIIKYFTLVAVGVPSDQLRITYAASLTLNQAHMVLSFYPTPESEPLILDSLESKILKASARPDLKPVYSFNAEGLWLAKTRGESSLMGDSKSLGKWDALMKRME lapf-lapd 1339867 not-defined-88924066 1339869 unspecified role unspecified role bait bait q3kk32-- Q3KK32-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-944179849 1339870 unspecified role unspecified role prey prey Q3KK31:p.Trp125Glu Q3KK31-125-125 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 2 lapf-q5zxa3 1339867 not-defined-776411543 1339869 unspecified role unspecified role bait bait q3kk32-- Q3KK32-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-2072476750 1339871 unspecified role unspecified role prey prey Q5ZXA3:p.Trp126Glu Q5ZXA3-126-126 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 2 q5zxa4-lapd 1339867 not-defined-1412014193 1339870 unspecified role unspecified role prey prey Q3KK31:p.Trp125Glu Q3KK31-125-125 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false not-defined-624403667 1339872 unspecified role unspecified role bait bait q5zxa4-- Q5ZXA4-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 2 q5zxa4-q5zxa3 1339867 not-defined-915833545 1339872 unspecified role unspecified role bait bait q5zxa4-- Q5ZXA4-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1496891226 1339871 unspecified role unspecified role prey prey Q5ZXA3:p.Trp126Glu Q5ZXA3-126-126 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 2 q5zxa4-1 1339868 n/a 1339872 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. 3 1.645 A (4FGQ) Rworking = 0.19 Rfree = 0.22 (4FGQ) lubx-cdk11b 1333067 n/a 1333070 unspecified role unspecified role prey prey not-defined-860060462 1333071 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false Q5ZRQ0:p.Ile45Ala Q5ZRQ0-39-39 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false region Q5ZRQ0-1-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4A lubx-cdk11b-1 1333068 n/a 1333070 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-419555708 1333071 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4B lubx-cdk11b-2 1333069 n/a 1333070 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-419555708 1333071 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false Fig. 4B rab1a-q5zwz3 1339505 not-defined-491691964 1339506 unspecified role unspecified role bait bait gln70leu P62820-70-70 mutation mutation certain certain sequence position certain certain certain sequence position certain false ser25asn P62820-25-25 mutation mutation certain certain sequence position certain certain certain sequence position certain false not-defined-105887700 1339507 unspecified role unspecified role prey prey region Q5ZWZ3-190-600 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3 rab1a-golga2-1 1339505 n/a 1339508 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1339509 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1339510 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. not-defined-491691964 1339506 unspecified role unspecified role bait bait region P62820-25-25 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P62820:p.Ser25Asn P62820-70-70 mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) association association false false false Figure 1E rab1a-golga2-2 1339505 not-defined-491691964 1339506 unspecified role unspecified role bait bait region P62820-25-25 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P62820:p.Gln70Leu P62820-70-70 mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1339510 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1339508 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association false false false Figure 1E LidA (Legionella pneumophila)