IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hermann-2015-1 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Hermann C., van Hateren A., Trautwein N., Neerincx A., Duriez PJ., Stevanović S., Trowsdale J., Deane JE., Elliott T., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. "Peptide-receptive" HLA-A*02:01 and HLA-B*08:01 (HLA-B*08:01fos or HLA-B*08:01fos T134K molecules) were obtained by exposing the monomeric MHC class I complexes with UV labile peptides(for HLA-A*02:01= KILGFVFjV (j represents 3-amino-3-(2-nitro) phenyl-propionic acid and for HLA-B*08:01 =FLRGRAjGL) to ∼360 nm light for 20 min at 4°C ('UV exposed'). MHC class I molecules were subsequently allowed to bind to fluorescent peptides and dissociation of the fluorescent peptide was subsequently followed after the addition of excess non-labelled competitor peptide in the absence or presence of TAPBPR or other proteins. HLA-B*08:01fos or HLA-B*08:01fos T134K molecules HLA A*0201/HLA B:0801:-DNA encoding the "ER luminal domains" was used; but the residue numbering of these domains is not stated;it has been assumed to be the domains before the transmembrane region. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk eLife 2015 imex curation Only protein-protein interactions hermann-2015-2 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Hermann C., van Hateren A., Trautwein N., Neerincx A., Duriez PJ., Stevanović S., Trowsdale J., Deane JE., Elliott T., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. "Peptide-receptive" HLA-A*02:01 and HLA-B*08:01 were obtained by exposing the monomeric MHC class I complexes with UV labile peptides(for HLA-A*02:01= KILGFVFjV (j represents 3-amino-3-(2-nitro) phenyl-propionic acid and for HLA-B*08:01 =FLRGRAjGL) to ∼360 nm light for 20 min at 4°C ('UV exposed'). The binding of fluorescent peptides to UV-exposed MHC class I was monitored in the absence and the presence of TAPBPR or I285K mutant. The Uniprot entry for the UV-labile peptide KILGFVFjV (j represents 3-amino-3-(2-nitro) phenyl-propionic acid) -UniProt Q6DPU2, influenza Matrix 1 epitope; this was derived from the sequence GILGFVFTL - see PMID:17406393 HLA A*0201/B0801:-DNA encoding the "ER luminal domains" was used; but the residue numbering of these domains is not stated;it has been assumed to be the domains before the transmembrane region. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk eLife 2015 imex curation Only protein-protein interactions capsd_hbvh3 Capsid protein C Core antigen Core protein HBcAg p21.5 protein protein isolate Nicaragua/2928Nic/1997 Hepatitis B virus genotype H subtype adw4 HBV-H MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC 1a02_human HLA class I histocompatibility antigen, A-2 alpha chain HLA-A HLAA Human leukocyte antigen A*02 protein protein human Homo sapiens Human MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGGSYSQAASSDSAQGSDVSLTACKV Deprecated HLA-A AC, merged into a different UniProt canonical but we have mutation features in variable positions. Allele =A*02:01:01:01 Allele =A*02:01:01:01 according to IPD-IMGT/HLA database b2mg_human Beta-2-microglobulin B2M CDABP0092 HDCMA22P protein protein human Homo sapiens Human MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM m1_i02a1 Matrix protein 1 M protein protein Influenza A virus (strain A/Guinea fowl/Hong Kong/38/2002 H5N1 genotype X0) Influenza A virus (strain A/Guinea fowl/Hong Kong/38/2002 H5N1 genotype X0) ETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYSTGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATITNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPNSSTGLRDNLLENLQAYQNRMGVQMQRFK 1b08_human_deprecated MHC class I antigen B*8 HLA-B HLAB protein protein human Homo sapiens Human MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA This protein is not up-to-date anymore with the uniprot protein because of feature conflicts. ebna3_ebvg Epstein-Barr nuclear antigen 3 Epstein-Barr nuclear antigen 3A BLRF3-BERF1 EBNA3 protein protein ebvg Epstein-Barr virus (strain B95-8) Human herpesvirus 4 MDKDRPGDPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAQLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYAMAIRQAIRDRRRNPASRRDQAKWRLQTLAAGWPMGYQAYSSWMYSYTDHQTAPTFVQLQATLGCTGGRRCHVTFSAGTFKPPRCTPGDRQWLYVQSSVGNIVQSCNPRYSIFFDYMAIHRSLTKIWEEVLTPDQRVSFMEFLGFLQRTDLSYIKSFVSDALGTTSIQTPWIDDNSSTETAQAWNAGFLRGRAYGLDLLRTEGEHVEGATGETREESEDTESDGDDEDLPCIVSRGGPKVKRPPIFIRRLHRLLLMRAGKRTEQGKEVLEKARGSTYGTPRPPVPKPRPEVPQSDETATSHGSAQVPEPPTIHLAAQGMAYPLHEQRGMAPCPVAQAPHTPLPPVSPGDQLPGVSSDGRVACAPVPAPAGPIVRPWEPSLTQAAGQAFAPVRPQHMPVEPVPVPTVALERPVYPKPVRPAPPKIAMQGPGETSGIRRARERWRPAPWTPNPPRSPSQMSVRDRLARLRAEAQVKQASVEVQPPQVTQVSPQQPMEGPGAPFSQVADVVHTPGVPAMQPQYFDLPLIQPISQGAPVAPLRASMGPVPPVPATQPQYFDIPLTEPINQGASAAHFLPQQPMEGPLVPEQWMFPGAALSQSVRPGVAQSQYFDLPLTQPITHGAPAAHFLHQPPMEGPWVPEQWMFQGAPPSQGTDVVQHQLDALGYPLHALNHPGVPVSPAVNQYHLSQAAFGLPIDEDESGEGSDTSEPCEALDLSIHGRPCPQAPEWPVQGEGGQDATEVLDLSIHGRPRPRTPEWPVQGESGQNVTDHEPRRVVVSAIVHMCQDDEFPDLQDPPDEA gag_hv1w2 Gag polyprotein gag Pr55Gag protein protein isolate WMJ22 Human immunodeficiency virus type 1 group M subtype B HIV-1 MGARASVLSGGELDKWEKIRLRPGGKKKYRLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEKKDTKEALDKIEEEQNKCKKKAQQAAADTGNSSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQATQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPTTIMMQKGNFRNQRKT pp65_hcmvt 65 kDa phosphoprotein UL83 64 kDa matrix phosphoprotein GP64 Phosphoprotein UL83 Tegument protein UL83 protein protein hcmvt Human cytomegalovirus (strain Towne) Human herpesvirus 5 MASVLGPISGHVLKAVFSRGDTPVLPHETRLLQTGIHVRVSQPSLILVSQYTPDSTPCHRGDNQLQVQHTYFTGSEVENVSVNVHNPTGRSICPSQEPMSIYVYALPLKMLNIPSINVHHYPSAAERKHRHLPVADAVIHASGKQMWQARLTVSGLAWTRQQNQWKEPDVYYTSAFVFPTKDVALRHVVCAHELVCSMENTRATKMQVIGDQYVKVYLESFCEDVPSGKLFMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLCPKNMIIKPGKISHIMLDVAFTSHEHFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTAGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQGQNLKYQEFFWDANDIYRIFAELEGVWQPAAQPKRRRHRQDALPGPCIASTPKKHRG tpsnr_human Tapasin-related protein TAPBPL TAP-binding protein-like TAP-binding protein-related protein Tapasin-like protein protein human Homo sapiens Human MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLAKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAAWFMANMQVSGGGPSISLVMKTPRVTKNEALWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGTYICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVTWTREELGGSPAQVSGASFSSLRQSVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLFLLALMFLGLQRRQAPTGLGLLQAERWETTSCADTQSSHLHEDRTARVSQPS b2m-c-1 2964522 N/A 2964538 competitor competitor competitor neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964526 unspecified role unspecified role neutral component neutral component mature_protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2964525 unspecified role unspecified role neutral component neutral component P0C6I6:p.Phe23Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tamra_tag rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964527 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminal_leucine_zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2964528 unspecified role unspecified role neutral component neutral component Q9BX59:p.Ile285Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminal_signal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 2964791 2964785 physical association physical association false false false 2 B HLA-A*0201 allele In the absence of TAPBPR there is no dissociation. b2m-c-2 2964522 N/A 2964525 competitor competitor competitor neutral component neutral component P0C6I6:p.Phe23Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964526 unspecified role unspecified role neutral component neutral component mature_protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2964525 unspecified role unspecified role neutral component neutral component P0C6I6:p.Phe23Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tamra_tag rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964527 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminal_leucine_zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2964528 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminal_signal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 2964809 2964803 physical association physical association false false false 2 A HLA-A*0201 allele In the absence of TAPBPR there is no dissociation. b2m-c-12 2964522 N/A 2964539 competitor competitor competitor neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964526 unspecified role unspecified role neutral component neutral component mature_protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2964539 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tamra_tag rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 2964540 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminal_leucine_zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false p.Thr158Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2964528 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminal_signal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 2964824 2964819 physical association physical association false false false 4 A/B HLA-B*0801 allele TAPBPR did not significantly enhance dissociation of two additional peptides, ELRSRK*WAI and FLRGRK*YGL from HLA-B*08:01. (Figs 4 C/D) tapbpl-hla_a-3 2964523 N/A 2964525 competitor competitor competitor neutral component neutral component tamra_tag rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain false P0C6I6:p.Phe23Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964526 unspecified role unspecified role neutral component neutral component mature_protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2964541 unspecified role unspecified role neutral component neutral component Q6DPU2:p.[Gly51Lys;Thr58_Leu59delinsXaaVal] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964527 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminal_leucine_zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2964528 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminal_signal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9BX59:p.Ile285Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 2964842 2964837 physical association physical association false false false 2 C HLA-A*0201 allele b2m-c-3 2964523 N/A 2964541 unspecified role unspecified role neutral component neutral component Q6DPU2:p.[Gly51Lys;Thr58_Leu59delinsXaaVal] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964526 unspecified role unspecified role neutral component neutral component mature_protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2964525 competitor competitor competitor neutral component neutral component P0C6I6:p.Phe23Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tamra_tag rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964527 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminal_leucine_zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2964528 unspecified role unspecified role neutral component neutral component Q9BX59:p.Ile285Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminal_signal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 2964860 2964854 physical association physical association false false false 2 D HLA-A*0201 allele Mixtures of the high affinity labelled peptide FLPSDC*FPSV and a variable concentration of the peptide NLVPMVATV were added. In the presence of TAPBPR, the lower affinity peptide NLVPMVATV became a poorer competitor. b2m-gag-1 2964523 N/A 2964542 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q3KST2:p.Tyr331Xaa mutation mutation certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2964526 unspecified role unspecified role neutral component neutral component mature_protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2964539 competitor competitor competitor neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tamra_tag rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 2964540 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminal_leucine_zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false p.Thr158Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2964528 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminal_signal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 2964877 2964872 physical association physical association false false false 4 E HLA-B*0801 allele The enhancement of binding by TAPBPR was only observed when using the EIYK*RWIIL peptide.