mpidb The Microbial Protein Interaction Database lowenthal-2009-1 Functional analysis of the Helicobacter pylori flagellar switch proteins. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lowenthal A.C., Hill M., Sycuro L.K., Mehmood K., Salama N.R., Ottemann K.M. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation carpenter-2010-1 Mutagenesis of conserved amino acids of Helicobacter pylori fur reveals residues important for function. helpx Helicobacter pylori Campylobacter pylori crosslink cross-linking study crosslink predetermined predetermined participant predetermined Carpenter B.M., Gancz H., Benoit S.L., Evans S., Olsen C.H., Michel S.L., Maier R.J., Merrell D.S. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation b5zae7_helpg cheY HPG27_361 protein protein helpg Helicobacter pylori (strain G27) MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTND q9zm30_helpj Flagellar motor switch protein FliM fliM jhp_0393 protein protein helpj Helicobacter pylori J99 Campylobacter pylori J99 MADILSQEEIDALLEVVDENVDIQNVQKKDIIPQRSVTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQNREFSDIELNLLDTILRQVMQILKEVWSPVVEMYPTIDAKESSANVVQIVAQNEISIMVVLEIIIGHSRGMMNICYPVISIESILSKMGSRDFMLSETNSKKSRNKELQALLSGVSVDMMVFLGAVELSLKEMLDLDVGDTIRLNKVANDEVSVYVHKKKRYLASVGFQGYRKTIQIKEVVYSEKERTKEILEMLEEQRRGKVGDIMKIEEE b5z6g7_helpg Ferric uptake regulation protein fur HPG27_401 protein protein helpg Helicobacter pylori (strain G27) MKRLETLESILERLRMSIKKNGLKNSKQREEVVSVLYRSGTHLSPEEITHSIRQKDKNTSISSVYRILNFLEKENFICVLETSKSGRRYEIAAKEHHDHIICLHCGKIIEFADPEIENRQNEVVKKYQAKLISHDMKMFVWCKECQESEY flim-chey 1336501 n/a 1336502 unspecified role unspecified role prey prey helpg Helicobacter pylori (strain G27) n/a 1336503 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 4 b5z6g7 1337653 n/a 1337654 unspecified role unspecified role unspecified role unspecified role B5Z6G7:p.His96Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false B5Z6G7:p.Glu110Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 physical association physical association false false false figure 8 b5z6g7-1 1337653 n/a 1337654 unspecified role unspecified role unspecified role unspecified role B5Z6G7:p.His96Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false B5Z6G7:p.Glu110Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false n/a 1337654 unspecified role unspecified role unspecified role unspecified role B5Z6G7:p.Glu110Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false B5Z6G7:p.His96Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 8 MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lamb-2009-1 Helicobacter pylori CagA activates NF-kappaB by targeting TAK1 for TRAF6-mediated Lys 63 ubiquitination. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Lamb A., Yang XD., Tsang YH., Li JD., Higashi H., Hatakeyama M., Peek RM., Blanke SR., Chen LF. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation lamb-2009-3 Helicobacter pylori CagA activates NF-kappaB by targeting TAK1 for TRAF6-mediated Lys 63 ubiquitination. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lamb A., Yang XD., Tsang YH., Li JD., Higashi H., Hatakeyama M., Peek RM., Blanke SR., Chen LF. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation lamb-2009-2 Helicobacter pylori CagA activates NF-kappaB by targeting TAK1 for TRAF6-mediated Lys 63 ubiquitination. human-ags Homo sapiens caucasian gastric adenocarcinoma cell line AGS ags Human caucasian gastric adenocarcinoma cell line AGS Derived from an adenocarcinoma of the stomach of a 54 year old Caucasian female with no prior anti-cancer treatment. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lamb A., Yang XD., Tsang YH., Li JD., Higashi H., Hatakeyama M., Peek RM., Blanke SR., Chen LF. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation b5z6s0_helpg cagA HPG27_507 protein protein helpg Helicobacter pylori (strain G27) MTNETINQQPQTEAAFNPQQFINNLQVAFLKVDNAVASYDPDQKPIVDKNDRDNRQAFNGISQLREEYSNKAIKNPAKKNQYFSDFIDKSNNLINKDALIDVESSTKSFQKFGDQRYQIFTSWVSHQNDPSKINTRSIRNFMENIIQPPIPDDKEKAEFLKSAKQSFAGIIIGNQIRTDQKFMGVFDESLKERQEAEKNGGPTGGDWLDIFLSFIFDKKQSSDVKEAINQEPVPHVQPDIATTTTDIQGLPPEARDLLDERGNFSKFTLGDMEMLDVEGVADIDPNYKFNQLLIHNNALSSVLMGSHNGIEPEKVSLLYGGNGGPKAKHDWNATVGYKDQQGNNVATIINVHMKNGSGLVIAGGEKGINNPSFYLYKEDQLTGSQRALSQEEIRNKVDFMEFLAQNNAKLDNLSEKEEEKFRNEIKDFQKDSKAYLDALGNDRIAFVSKKDTKHSALITEFGNGDLSYTLKDYGKKADKALDREKNVTLQGNLKHDGVMFVDYSNFKYTNASKNPNKGVGVTNGVSHLEAGFSKVAVFNLPDLNNLAITSLVRRDLEDKLIAKGLSPQETNKLVKDFLSSNKELVGKALNFNKAVAEAKNTGNYDEVKQAQKDLEKSLKKRERLEKEVAKKLESKSGNKNKMEAKSQANSQKDEIFALINKEANREARAITYAQNLKGIKRELSDKLENVNKNLKDFSKSFDEFKNGKNKDFSKSEETLKALKGSVKDLGINPEWISKVENLNAALNEFKNGKNKDFSKVTQAKSDLENSVKDVIINQKVTDKVDNLNQAVSVAKATGDFSRVEQALADLKNFSKEQLAQQAQKNEDFNTGKNSALYQSVKNGVNGTLVGNGLSKAEATTLSKNFSDIKKELNAKLGNFNNNNNNGLKNSTEPIYAKVNKKKAGQAASPEEPIYAQVAKKVNAKIDRLNQIASGLGVVGQAVGFPLKRHDKVGDLSKVGQSVSPEPIYATIDDLGGPFPLKRHDKVGDLSKVGLSVSPEPIYATIDDLGGPFPLKRHDKVGDLSKVGLSREQQLKQKIDNLSQAVSEAKAGFFGNLEQTIDNLKDSAKNNPVSLWAEGAKKVPASLSAKLDNYATNSHTRINSNIQSGAINEKATGMLTQKNPEWLKLVNDKIVAHNVGSVPLLEYDKIGFNQKSMKDYSDSFKFSTELNNAVKDVKSGFTQFLANAFSTGYYRLAGENAEHGIKNVNTKGGSKNLKGLRNTKNAKTTPC mint m3k7_human Mitogen-activated protein kinase kinase kinase 7 MAP3K7 TAK1 Transforming growth factor-beta-activated kinase 1 protein protein human Homo sapiens Human MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV ubc_human Polyubiquitin-C UBC protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV map3k7-ubc 862344 ubc_human Ubiquitin 862347 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false m3k7_human TAK1 862348 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint proteins taxid has not been specified. f3b f3c f5a sf6 sf16 caga-map3k7 862344 b5z6s0_helpg cagA 862349 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false m3k7_human TAK1 862348 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4a mint TAK1 taxid has not been specified. map3k7-ubc-1 862344 m3k7_human TAK1 862348 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ubc_human Ubiquitin 862347 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint proteins taxid has not been specified. sf7 sf14 traf6-map3k7-2 862344 traf6_human TRAF6 862350 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell t7 tagged t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false m3k7_human TAK1 862348 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint proteins taxid has not been specified. sf19 traf6-ubc-1 862344 ubc_human Ubiquitin 862347 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false traf6_human TRAF6 862350 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell t7 tagged t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint proteins taxid has not been specified. sf21 caga-map3k7-1 862345 b5z6s0_helpg cagA 862349 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false m3k7_human TAK1 862348 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false direct interaction direct interaction false false false mint TAK1 taxid has not been specified. sf9 sf10 sf11 caga-map3k7-2 862345 b5z6s0_helpg cagA 862349 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false m3k7_human TAK1 862348 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false mint TAK1 taxid has not been specified. sf9 sf10 sf11 caga-traf6 862345 b5z6s0_helpg cagA 862349 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false traf6_human TRAF6 862350 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated direct interaction direct interaction false false false mint proteins taxid has not been specified. sf20 map3k7-caga 862346 b5z6s0_helpg cagA 862349 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level m3k7_human TAK1 862348 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4b mint map3k7-ubc-2 862346 m3k7_human TAK1 862348 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ubc_human Ubiquitin 862347 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3a homomint mint