mpidb The Microbial Protein Interaction Database thomas-2009-1 A fratricidal mechanism is responsible for eDNA release and contributes to biofilm development of Enterococcus faecalis. in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Thomas V.C., Hiromasa Y., Harms N., Thurlow L., Tomich J., Hancock L.E. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation gele_entfa Gelatinase gelE Coccolysin EF_1818 protein protein entfa Enterococcus faecalis (strain ATCC 700802 / V583) MMKGNKILYILGTGIFVGSSCLFSSLFVAAEEQVYSESEVSTVLSKLEKEAISEAAAEQYTVVDRKEDAWGMKHLKLEKQTEGVTVDSDNVIIHLDRNGAVTSVTGNPVDQVVKIQSVDAIGEEGVKKIIASDNPETKDLVFLAIDKRVNNEGQLFYKVRVTSSPTGDPVSLVYKVNATDGTIMEKQDLTEHVGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYSSLVNYLTPKAQFSDARDAMLAAAKVQYGDEAASVVSAAFNSAGIGAKEDIQVNQPSESVLVNE alys_entfa Autolysin Beta-glycosidase Peptidoglycan hydrolase EF_0799 protein protein entfa Enterococcus faecalis (strain ATCC 700802 / V583) MKKESMSRIERRKAQQRKKTPVQWKKSTTLFSSALIVSSVGTPVALLPVTAEATEEQPTNAEVAQAPTTETGLVETPTTETTPGTTEQPTTDSSTTTESTTESSKETPTTPSTEQPTADSTTPVESGTTDSSVAEITPVAPSATESEAAPAVTPDDEVKVPEARVASAQTFSALSPTQSPSEFIAELARCAQPIAQANDLYASVMMAQAIVESGWGASTLSKAPNYNLFGIKGSYNGQSVYMDTWEYLNGKWLVKKEPFRKYPSYMESFQDNAHVLKTTSFQAGVYYYAGAWKSNTSSYRDATAWLTGRYATDPSYNAKLNNVITAYNLTQYDTPSSGGNTGGGTVNPGTGGSNNQSGTNTYYTVKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFVGQKLIVKKGASGNTGGSGSGGSNNNQSGTNTYYTVKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFVGQKLIVKKGASGNTGGSNNGGSNNNQSGTNTYYTIKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFAGQKIIVKKGTSGNTGGSSNGGSNNNQSGTNTYYTIKSGDTLNKISAQFGVSVANLQAWNNISGSLIFAGQKIIVKKGANSGSTNTNKPTNNGGGATTSYTIKSGDTLNKISAQFGVSVANLRSWNGIKGDLIFAGQTIIVKKGASAGGNASSTNSASGKRHTVKSGDSLWGLSMQYGISIQKIKQLNGLSGDTIYIGQTLKVG q833v8_entfa Serine protease EF_1817 protein protein entfa Enterococcus faecalis (strain ATCC 700802 / V583) MKKFSIRKISAGFLFLILVTLIAGFSLSANAEEYIVPAESHSRQKRSLLDPEDRRQEVADTTEAPFASIGRIISPASKPGYISLGTGFVVGTNTIVTNNHVAESFKNAKVLNPNAKDDAWFYPGRDGSATPFGKFKVIDVAFSPNADIAVVTVGKQNDRPDGPELGEILTPFVLKKFESSDTHVTISGYPGEKNHTQWSHENDLFTSNFTDLENPLLFYDIDTTGGQSGSPIYNDQVEVVGVHSNGGIKQTGNHGQRLNEVNYNFIVNRVNEEENKRLSAVPAA alys-gele 1335844 not-defined-1333256061 1335845 enzyme enzyme neutral component neutral component entfa Enterococcus faecalis (strain ATCC 700802 / V583) not-defined-1534000874 1335846 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli cleavage cleavage reaction cleavage false false false Fig. 6B alys-q833v8 1335844 n/a 1335847 enzyme enzyme unspecified role unspecified role entfa Enterococcus faecalis (strain ATCC 700802 / V583) not-defined-2085563291 1335846 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli cleavage cleavage reaction cleavage false false false Fig. 6B DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ crepin-2006-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Crepin T., Yaremchuk A., Tukalo M., Cusack S. DIP original experiment: DIP-66374X Structure (London, England : 1993) 2006 IMEx Structures of two bacterial prolyl-tRNA synthetases with and without a cis-editing domain. Crepin T., Yaremchuk A., Tukalo M., Cusack S. Only protein-protein interactions imex curation lundqvist-2007-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253325X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions imex curation lundqvist-2007-11 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253326X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions imex curation lundqvist-2007-13 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253327X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions imex curation lundqvist-2007-15 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253328X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions imex curation syp_entfa Proline--tRNA ligase proS Prolyl-tRNA synthetase EF_2379 protein protein entfa Enterococcus faecalis (strain ATCC 700802 / V583) MKQSKMLIPTLREVPNDAEVLSHQILLRAGYIRQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRSRSGLLRGREFIMKDGYSFHADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFFEVEPQRIIKSVLFIADEEPVMVLVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQDLANAIVGANEDGYHLTNVNPDRDFQPISYEDLRFVQEGDPSPDGNGVLAFTKGIEIGHIFKLGTRYSDAMGATVLDENGREKSVIMGCYGIGVSRLLSAIVEQNADERGINWPTGIAPFDLHVVQMNVKDEYQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADLIGCPIRITVGKKAVDGVVEVKIKRTGEMLEVRKEELESTLSILMNTTSEVE D2267BE6E4A85998 muri_entfa Glutamate racemase murI EF_1121 protein protein entfa Enterococcus faecalis (strain ATCC 700802 / V583) MSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTATAVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPTIEVTSLDCPKFVPIVESNQYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPEAPTQPHEFYTTGSAKMFEEIASSWLGIENLKAQQIHLGGNEND prsef-1 3148801 N/A 3148803 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false muri-9 3157683 N/A 3157693 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false muri-11 3157685 N/A 3157693 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false muri-13 3157687 N/A 3157693 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false muri-15 3157689 N/A 3157693 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint brugna-2010-1 In vivo production of catalase containing haem analogues. entfa Enterococcus faecalis (strain ATCC 700802 / V583) imaging technique imaging technique microscopy predetermined predetermined participant predetermined Brugna M., Tasse L., Hederstedt L. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation q834p5_entfa Catalase katA EF_1597 protein protein entfa Enterococcus faecalis (strain ATCC 700802 / V583) MKNQHLTTSQGSPVGDNQNSLTAGEFGPVLIQDVHLLEKLAHFNRERVPERVVHAKGAGAHGIFKVSQSMAQYTKADFLSEVGKETPLFARFSTVAGELGSSDTLRDPRGFALKFYTDEGNYDLVGNNTPIFFIRDAIKFPDFIHSQKRNPRTHLKSPEAVWDFWSHSPESLHQVTILMSDRGIPLSFRHMHGFGSHTFKWVNAAGEVFFVKYHFKTNQGIKNLESQLAEEIAGKNPDFHIEDLHNAIENQEFPSWTLSVQIIPYADALTMKETLFDVTKTVSQKEYPLIEVGTMTLNRNPENYFAEVEQVTFSPGNFVPGIEASPDKLLQGRLFAYGDAHRHRVGANSHQLPINQAKAPVNNYQKDGNMRFNNGNSEINYEPNSYTETPKEDPTAKISSFEVEGNVGNYSYNQDHFTQANALYNLLPSEEKENLINNIAASLGQVKNQEIIARQIDLFTRVNPEYGARVAQAIKQQA mint kata-2 896641 q834p5_entfa katA 896642 western blot western blot Immuno blot Immuno blot unspecified role unspecified role unspecified role unspecified role subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 physical association physical association false false false f1 mint kata-2 896641 q834p5_entfa katA 896642 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role unspecified role unspecified role subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 physical association physical association false false false f2 mint