IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2021-19 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-18 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-17 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-20 human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-21 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma rna-ip rna immunoprecipitation rna-ip qrt-pcr quantitative reverse transcription pcr QRT-PCR Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins RNA-IP; No cross linking was carried out prior to IP. This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-22 mouse-dbt mouse astrocytoma cell line dbt dbt mouse astrocytoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins DBT-ACE2 (mouse astrocytoma cell line) cells stably expressing the murine ACE2 receptor. This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-23 human-calu_3 Homo sapiens lung adenocarcinoma calu_3 male caucasian lung adenocarcinoma ATCC number - HTB-55 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins Bronchial epithelial cell line Calu-3 2B4; Calu-3 cells stably expressing ACE2. This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus tiar_human Nucleolysin TIAR TIAL1 TIA-1-related protein protein protein human Homo sapiens Human MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ mov10_human Helicase MOV-10 Moloney leukemia virus 10 protein MOV10 KIAA1631 Armitage homolog protein protein human Homo sapiens Human MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYGMKIANLAYVTKTRVRFFRLDRWADVRFPEKRRMKLGSDISKHHKSLLAKIFYDRAEYLHGKHGVDVEVQGPHEARDGQLLIRLDLNRKEVLTLRLRNGGTQSVTLTHLFPLCRTPQFAFYNEDQELPCPLGPGECYELHVHCKTSFVGYFPATVLWELLGPGESGSEGAGTFYIARFLAAVAHSPLAAQLKPMTPFKRTRITGNPVVTNRIEEGERPDRAKGYDLELSMALGTYYPPPRLRQLLPMLLQGTSIFTAPKEIAEIKAQLETALKWRNYEVKLRLLLHLEELQMEHDIRHYDLESVPMTWDPVDQNPRLLTLEVPGVTESRPSVLRGDHLFALLSSETHQEDPITYKGFVHKVELDRVKLSFSMSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWLLWPMLFPVAPRDVPLLPSDVKLKLYDRSLESNPEQLQAMRHIVTGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKPCCNWDAKKGEYVFPAKKKLQEYRVLITTLITAGRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMEVKETGDPGGQLVLAGDPRQLGPVLRSPLTQKHGLGYSLLERLLTYNSLYKKGPDGYDPQFITKLLRNYRSHPTILDIPNQLYYEGELQACADVVDRERFCRWAGLPRQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPKRFNVAVTRAKALLIIVGNPLLLGHDPDWKVFLEFCKENGGYTGCPFPAKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWRNEL k0bvn3_mers Nucleoprotein N Nucleocapsid protein protein protein cv2ce Human betacoronavirus 2c EMC/2012 MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWYTGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYYTGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNFHIEGTGGNSQSSSRASSLSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDLLNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQGNFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGAIKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSITQRTRTRPSVQPGPMIDVNTD ago2_human Protein argonaute-2 AGO2 Argonaute RISC catalytic component 2 EIF2C2 Eukaryotic translation initiation factor 2C 2 PAZ Piwi domain protein Protein slicer protein protein human Homo sapiens Human MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA rent1_human Regulator of nonsense transcripts 1 UPF1 RENT1 KIAA0221 ATP-dependent helicase RENT1 Nonsense mRNA reducing factor 1 Up-frameshift suppressor 1 homolog protein protein human Homo sapiens Human MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY ncap_cvh22 Nucleoprotein N Nucleocapsid protein 7 protein protein hcov-229e Human coronavirus 229E HCoV-229E MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN mint homomint g-rna human betacoronavirus 2c emc/2012 rna ribonucleic acid RNA rna cv2ce Human betacoronavirus 2c EMC/2012 mov10_mouse Putative helicase MOV-10 Mov10 Gb110 Moloney leukemia virus 10 protein protein protein mouse Mus musculus Mouse MPSKFSCRKLRETGQRFESFLAERGLDLETDRERLRTIYNHDFKPSYGTPAPGFSSMLYGMKIANLAFVTKTRVRFFKLDRWADVQLPEKRRIKPGSNISKQHRSLLARIFHDRAEYLHGKHGVDVEVQGPHEARDGQLLIHLDLNRKEVLTLRLRNGGSKPVTLTHLFPLCWTPQFVFYHGEQDLPCPLGPGESYELHIYCKTSIVGYFPATVLWELLGPGESGAEGAETFYIARFLAAVAHSPLAAQLKPTTPFKRPPRLTRNSVLTNRIEEGERPDRAKGYELELSLALGTYYPPILLRQLLPTLLQGPSIFTAPKEVAEIKAQLETTLKSRNYEVKLRLLLHLEELQMEHDIRHYDLDSVPMTWDPVDQNPRLLTLEVPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHKVELDRVKLSFSTSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWVLWPMLFPVASRGVSLLPSDVKFKLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKTCCNWDAKKGEYVYPAKKHLQQYRVLITTLITASRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKKGPNGYDPQFITKLLRNYRSHPTILDIPNQLYYDGELQACADVVDRERFCRWEGLPQQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPKRFNVAVTRAKALLIVVGNPLLLGHDPDWKTFLEFCKENGGYTGCPFPAKLDLQQGQDLLQGLSKLSPSTSGPRRHQNLPQEREGEGGLPLQVEPEWRNEL mint May be an helicase with an important function in development and/or control of cell proliferation ncap_sars Nucleoprotein N 9a Nucleocapsid protein protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA mint Major structural component of virions that associates with genomic RNA to form a long, flexible, helical nucleocapsid ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA tial1-mov10-2 4086420 N/A 4086427 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086428 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false association association false false false 2D tial1-mov10-1 4086420 N/A 4086427 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086428 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 2D Weak interaction. The text states:-"Endogenous MOV10 protein interaction in mock-infected cells was detected only for TIAR." ago2-mov10-1 4086420 N/A 4086430 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086428 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false association association false false false 2D upf1-mov10-1 4086420 N/A 4086431 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086428 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false association association false false false 2D ago2-mov10-2 4086420 N/A 4086430 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false association association false false false 6D This interaction was seen in MOV10-KO cells. mov10-n-2 4086421 N/A 4086428 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Q9HCE1:p.[Lys530Ala;Asp645Asn] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 A/B, 7D RNAse The interaction of N protein with MOV10 was RNA dependant. mov10-n-6 4086421 N/A 4086432 unspecified role unspecified role prey prey infection infection N/A 4086428 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 8A The interaction of Mers N protein with MOV10 was RNA dependant, so it has been assumed the MOV10 interaction with other coronavirus N proteins may also be. mov10-n-1 4086422 N/A 4086428 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role neutral component neutral component infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 1A MOV10 extensively colocalized with MERS-CoV N protein in the cytoplasm, mainly in the larger granules. mov10-n-3 4086423 N/A 4086428 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role neutral component neutral component infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Supp. figure 1 MOV10 extensively colocalized with MERS-CoV N protein in the cytoplasm, mainly in the larger granules. mov10-to set_4-1 4086424 N/A 4086433 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N protein mRNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4086428 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 5 mov10-n-4 4086425 N/A 4086434 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086435 unspecified role unspecified role prey prey infection infection physical association physical association false false false 8A The interaction of Mers N protein with MOV10 was RNA dependant, so it has been assumed the MOV10 interaction with other coronavirus N proteins may also be. mov10-n-5 4086426 N/A 4086428 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086436 unspecified role unspecified role prey prey infection infection physical association physical association false false false 8A The interaction of Mers N protein with MOV10 was RNA dependant, so it has been assumed the MOV10 interaction with other coronavirus N proteins may also be.