IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wettstein-2021-1 in vitro In vitro cleavage cleavage assay cleavage predetermined predetermined participant predetermined Wettstein L., Weil T., Conzelmann C., Müller JA., Groß R., Hirschenberger M., Seidel A., Klute S., Zech F., Prelli Bozzo C., Preising N., Fois G., Lochbaum R., Knaff PM., Mailänder V., Ständker L., Thal DR., Schumann C., Stenger S., Kleger A., Lochnit G., Mayer B., Ruiz-Blanco YB., Hoffmann M., Sparrer KMJ., Pöhlmann S., Sanchez-Garcia E., Kirchhoff F., Frick M., Münch J. Virus - Publications including interactions involving viral proteins Creative BioMart have stated that TMPRSS2-1856H was used in this publication. Cleavage of the peptide-MCA substrate generated fluorescent AMC (7-amino-4-methyl-coumarin), which was subsequently detected. jan.muench@uni-ulm.de Nature communications 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wettstein-2021-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wettstein L., Weil T., Conzelmann C., Müller JA., Groß R., Hirschenberger M., Seidel A., Klute S., Zech F., Prelli Bozzo C., Preising N., Fois G., Lochbaum R., Knaff PM., Mailänder V., Ständker L., Thal DR., Schumann C., Stenger S., Kleger A., Lochnit G., Mayer B., Ruiz-Blanco YB., Hoffmann M., Sparrer KMJ., Pöhlmann S., Sanchez-Garcia E., Kirchhoff F., Frick M., Münch J. Virus - Publications including interactions involving viral proteins Creative BioMart have stated that TMPRSS2-1856H was used in this publication. jan.muench@uni-ulm.de Nature communications 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus tmps2_human Transmembrane protease serine 2 TMPRSS2 PRSS10 Serine protease 10 protein protein human Homo sapiens Human MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG boc-gln-ala-arg-methylcoumarin Boc-Gln-Ala-Arg-methylcoumarin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK camostat methanesulfonate camostat methanesulfonate Camostat mesilate Camostat monomethanesulfonate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) boc_gln_ala_arg_methylcoumarin-tmprss2-1 4048558 N/A 4048560 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 4048561 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) cleavage cleavage reaction cleavage false false false 5D boc_gln_ala_arg_methylcoumarin-serpina1-1 4048558 N/A 4048560 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 4048562 inhibitor inhibitor neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma N/A 4048561 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) cleavage cleavage reaction cleavage false false false 5D boc_gln_ala_arg_methylcoumarin-camostat methanesulfonate-1 4048558 N/A 4048560 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 4048563 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4048561 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) cleavage cleavage reaction cleavage false false false 5D tmprss2-serpina1-1 4048559 N/A 4048562 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma N/A 4048560 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast cleavage cleavage reaction cleavage false false false 4048559 Supp. figure 8 B/C