DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cowan-2020-2 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. comigration in sds comigration in sds page comigration in sds experimental particp experimental participant identification experimental particp Cowan AD., Smith NA., Sandow JJ., Kapp EA., Rustam YH., Murphy JM., Brouwer JM., Bernardini JP., Roy MJ., Wardak AZ., Tan IK., Webb AI., Gulbis JM., Smith BJ., Reid GE., Dewson G., Colman PM., Czabotar PE. czabotar@wehi.edu.au, pcolman@wehi.edu.au Nature structural & molecular biology 2020 imex curation Only protein-protein interactions imex curation cowan-2020-1 ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Cowan AD., Smith NA., Sandow JJ., Kapp EA., Rustam YH., Murphy JM., Brouwer JM., Bernardini JP., Roy MJ., Wardak AZ., Tan IK., Webb AI., Gulbis JM., Smith BJ., Reid GE., Dewson G., Colman PM., Czabotar PE. czabotar@wehi.edu.au, pcolman@wehi.edu.au Nature structural & molecular biology 2020 imex curation Only protein-protein interactions imex curation q16611-1 Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS bak1-27 4049468 N/A 4049470 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified Q16611-1:p.His164Cys H164C mutation mutation certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.[Met71Cys;Lys113Cys;His164Cys] M71C/K113C/H164C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. Stoichiometry: 2.0 direct interaction direct interaction false false false Fig 5b bak1-28 4049468 N/A 4049470 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified Q16611-1:p.[Met71Cys;Lys113Cys;His164Cys] M71C/K113C/H164C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.Trp125Pro W125P mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.Tyr136Phe Y136F mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.Arg137Ala R137A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. Stoichiometry: 2.0 direct interaction direct interaction false false false Fig 5d bak1-29 4049468 N/A 4049470 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified Q16611-1:p.[Met71Cys;Lys113Cys;His164Cys] M71C/K113C/H164C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.Trp125Pro W125P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.Tyr136Phe Y136F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.Arg137Ala R137A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. N/A 4049470 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified Q16611-1:p.[Met71Cys;Lys113Cys;His164Cys] M71C/K113C/H164C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.Trp125Pro W125P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.Tyr136Phe Y136F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q16611-1:p.Arg137Ala R137A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. direct interaction direct interaction false false false Fig 5d bak1-26 4049469 N/A 4049470 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role unspecified role unspecified role purified purified 68-148 Binding Region 68-148 Binding Region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Figure 1, Table 1