DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wu-2019-10 ecoli Escherichia coli (strain K12) 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Wu M., Lander GC., Herzik MA. mherzik@ucsd.edu Journal of structural biology: X 2019 Only protein-protein interactions imex curation imex curation wu-2019-11 ecoli Escherichia coli (strain K12) 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Wu M., Lander GC., Herzik MA. mherzik@ucsd.edu Journal of structural biology: X 2019 Only protein-protein interactions imex curation imex curation frih_mouse Ferritin heavy chain Fth1 Fth protein protein mouse Mus musculus Mouse MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLGHGDES aldoa_rabit Fructose-bisphosphate aldolase A ALDOA Muscle-type aldolase protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MPHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFISNHAY mint fth1-14 4050399 N/A 4050401 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 24.0 direct interaction direct interaction false false false Fig 2, Supplementary Fig 3, Table 1 aldoa-1 4050400 N/A 4050402 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false Fig 1, Supplementary Fig 1, Table 1