UniProt UniProt http://www.uniprot.org yoo-2019-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. yoonj@yonsei.ac.kr The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation yoo-2019-5 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. yoonj@yonsei.ac.kr The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation yoo-2019-1 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 proximity-dependent biotin identification proximity-dependent biotin identification sequence tag sequence tag identification sequence tag Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. yoonj@yonsei.ac.kr The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation yoo-2019-2 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. yoonj@yonsei.ac.kr The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation yoo-2019-3 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. yoonj@yonsei.ac.kr The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation ergi3_human Endoplasmic reticulum-Golgi intermediate compartment protein 3 Serologically defined breast cancer antigen NY-BR-84 ERGIC3 C20orf47 CGI-54 PRO0989 ERV46 SDBCAG84 protein protein human Homo sapiens Human MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT ergi2_human Endoplasmic reticulum-Golgi intermediate compartment protein 2 ERGIC2 ERV41 PTX1 CDA14 protein protein human Homo sapiens Human MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWMKYEYEVDKDFSSKLRINIDITVAMKCQYVGADVLDLAETMVASADGLVYEPTVFDLSPQQKEWQRMLQLIQSRLQEEHSLQDVIFKSAFKSTSTALPPREDDSSQSPNACRIHGHLYVNKVAGNFHITVGKAIPHPRGHAHLAALVNHESYNFSHRIDHLSFGELVPAIINPLDGTEKIAIDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSLMVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPFEDGHTDNHLPLLENNTH ergi1_human Endoplasmic reticulum-Golgi intermediate compartment protein 1 ER-Golgi intermediate compartment 32 kDa protein ERGIC1 KIAA1181 HT034 ERGIC32 protein protein human Homo sapiens Human MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKMH marh2_human E3 ubiquitin-protein ligase MARCHF2 MARCHF2 MARCH2 Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II RING finger protein 172 RING-type E3 ubiquitin transferase MARCHF2 RNF172 HSPC240 protein protein human Homo sapiens Human MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK lman1_human Protein ERGIC-53 LMAN1 ERGIC53 F5F8D ER-Golgi intermediate compartment 53 kDa protein Lectin mannose-binding 1 Gp58 Intracellular mannose-specific lectin MR60 protein protein human Homo sapiens Human MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF hpt_human Haptoglobin HP Zonulin protein protein human Homo sapiens Human MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN ergic2-ergic3-1 4105910 N/A 4105915 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105916 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 1A ergic3-ergic3-1 4105910 N/A 4105915 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105915 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 1B ergic3-ergic2-1 4105910 N/A 4105916 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105915 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 1B ergic3-ergic1-1 4105910 N/A 4105917 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105915 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 1B Weak interaction ergic3-marchf2-4 4105910 N/A 4105918 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105915 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3A marchf2-ergic3-1 4105910 N/A 4105915 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y282:p.[Lys6Arg;Lys8Arg] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 4105918 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3B-D serpina1-ergic3-1 4105910 N/A 4105915 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105919 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7A serpina1-lman1-1 4105910 N/A 4105920 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105919 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7A hp-ergic3-1 4105910 N/A 4105915 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105921 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7B serpina1-lman1-2 4105911 N/A 4105919 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105915 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 7C hp-ergic3-2 4105911 N/A 4105921 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4105915 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 7C ergic3-marchf2-1 4105912 N/A 4105915 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false lys8 ubiquitinylated lysine ubiquitinylated lysine certain certain sequence position certain certain certain sequence position certain false N/A 4105918 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed region bira tag bira tag BirA* biotin ligase tag BirA* tag bira biotin ligase tag bira tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9P0N8:p.[Cys64Ser;Cys67Ser] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 1A/B ergic3-marchf2-2 4105913 N/A 4105915 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9Y282:p.[Lys6Arg;Lys8Arg] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 4105918 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed Q9P0N8:p.[Cys64Ser;Cys67Ser] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 1C, 5B, 5E ergic3-marchf2-3 4105914 N/A 4105915 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4105918 anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q9P0N8:p.[Cys64Ser;Cys67Ser] mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2c