UniProt UniProt http://www.uniprot.org hsu-2017-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hsu JY., Crawley S., Chen M., Ayupova DA., Lindhout DA., Higbee J., Kutach A., Joo W., Gao Z., Fu D., To C., Mondal K., Li B., Kekatpure A., Wang M., Laird T., Horner G., Chan J., McEntee M., Lopez M., Lakshminarasimhan D., White A., Wang SP., Yao J., Yie J., Matern H., Solloway M., Haldankar R., Parsons T., Tang J., Shen WD., Alice Chen Y., Tian H., Allan BB. ballan@ngmbio.com Nature 2017 imex curation Only protein-protein interactions imex curation hsu-2017-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hsu JY., Crawley S., Chen M., Ayupova DA., Lindhout DA., Higbee J., Kutach A., Joo W., Gao Z., Fu D., To C., Mondal K., Li B., Kekatpure A., Wang M., Laird T., Horner G., Chan J., McEntee M., Lopez M., Lakshminarasimhan D., White A., Wang SP., Yao J., Yie J., Matern H., Solloway M., Haldankar R., Parsons T., Tang J., Shen WD., Alice Chen Y., Tian H., Allan BB. ballan@ngmbio.com Nature 2017 imex curation Only protein-protein interactions imex curation gfral_human GDNF family receptor alpha-like GFRAL C6orf144 UNQ9356/PRO34128 protein protein human Homo sapiens Human MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL gdf15_human Growth/differentiation factor 15 GDF15 MIC1 PDF PLAB PTGFB Placental bone morphogenetic protein Placental TGF-beta Macrophage inhibitory cytokine 1 Prostate differentiation factor NSAID-activated gene 1 protein NSAID-regulated gene 1 protein protein protein human Homo sapiens Human MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI gfral-gdf15-2 4102230 N/A 4102232 unspecified role unspecified role neutral component neutral component purified purified extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 4102233 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false Extended Data Table 1 gdf15-1 4102230 N/A 4102233 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f Stoichiometry: 2.0 direct interaction direct interaction false false false Extended Data Table 1 gfral-gdf15-1 4102231 N/A 4102232 unspecified role unspecified role bait bait purified purified extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 1.0 N/A 4102233 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f Stoichiometry: 1.0 direct interaction direct interaction false false false 4102231 Fig. 1E