UniProt UniProt http://www.uniprot.org urano-2005-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Urano J., Fox MS., Reijo Pera RA. reijo@itsa.ucsf Molecular reproduction and development 2005 Only protein-protein interactions imex curation imex curation urano-2005-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag western anti tag western blot anti tag western Urano J., Fox MS., Reijo Pera RA. The anti-AU1 Ab also detects the TAP tag. The blot was therefore reprobed with anti-Myc, after the TAP tag had been cleaved off. reijo@itsa.ucsf Molecular reproduction and development 2005 Only protein-protein interactions imex curation imex curation dazl_human Deleted in azoospermia-like DAZ-like autosomal Deleted in azoospermia-like 1 DAZ homolog SPGY-like-autosomal DAZL DAZH DAZL1 DAZLA SPGYLA protein protein human Homo sapiens Human MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV pum2_human Pumilio homolog 2 PUM2 KIAA0235 PUMH2 protein protein human Homo sapiens Human MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGASHHSMSQPIMVQRRSGQGFHGNSEVNAILSPRSESGGLGVSMVEYVLSSSPADKLDSRFRKGNFGTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQFDYPGNQVPMDSSGATVGLFDYNSQQQLFQRTNALTVQQLTAAQQQQYALAAAQQPHIAGVFSAGLAPAAFVPNPYIISAAPPGTDPYTAAGLAAAATLAGPAVVPPQYYGVPWGVYPANLFQQQAAAAANNTASQQAASQAQPGQQQVLRAGAGQRPLTPNQGQQGQQAESLAAAAAANPTLAFGQGLATGMPGYQVLAPTAYYDQTGALVVGPGARTGLGAPVRLMAPTPVLISSAAAQAAAAAAAGGTASSLTGSTNGLFRPIGTQPPQQQQQQPSTNLQSNSFYGSSSLTNSSQSSSLFSHGPGQPGSTSLGFGSGNSLGAAIGSALSGFGSSVGSSASSSATRRESLSTSSDLYKRSSSSLAPIGQPFYNSLGFSSSPSPIGMPLPSQTPGHSLTPPPSLSSHGSSSSLHLGGLTNGSGRYISAAPGAEAKYRSASSTSSLFSSSSQLFPPSRLRYNRSDIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQKLALATRIRGHVLPLALQMYGCRVIQKALESISSDQQVISEMVKELDGHVLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFVLSTHPYGCRVIQRILEHCTAEQTLPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKCVTHASRAERALLIDEVCCQNDGPHSALYTMMKDQYANYVVQKMIDMAEPAQRKIIMHKIRPHITTLRKYTYGKHILAKLEKYYLKNSPDLGPIGGPPNGML boll_human Protein boule-like BOLL BOULE protein protein human Homo sapiens Human MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY boule_drome Protein boule bol CG4760 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPAAGVPAIYPPSAMQYQPFYQYYSVPMNVPTIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQSPCWSIEDLRDTLPRV nanos_drome Protein nanos nos CG5637 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MFRSNLEGSGAAAVGVANPPSLAQSGKIFQLQDNFSAFHARGGLNILGLQDMYLDTSGANSSATLSPPITPVTPDPSTSAQSTHFPFLADSAATANSLLMQRQYHYHLLLQQQQQLAMAQHQLALAASAAAASASHQQTDEIARSLKIFAQVTTGAAENAAGSMQDVMQEFATNGYASDDLGRMSYGSAPPQVQMPPQQQHQQQQGLHLPLGRNPAQLQTNGGNLMPIPLATHWLNNYREHLNNVWRNMSYIPAAPNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKAESFRLAKSSYYKQQMKV dazl-pum2-1 4088237 N/A 4088239 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 4088240 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed pum2 region required to bind necessary binding region required to bind range range range range false pum4 region required to bind necessary binding region required to bind range range range range false pum8 region required to bind necessary binding region required to bind range range range range false physical association physical association false false false Fig. 4A boll-pum2-1 4088237 N/A 4088241 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4088240 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig. 1A, 3A, 4A BOL is able to interact with all PUF (Pumilio/FBF repeats) deletions of PUM2 tested bol-boll-1 4088237 N/A 4088241 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 4088242 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Fig. 2 bol-bol-1 4088237 N/A 4088242 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 4088242 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Fig. 2 nos-nos-1 4088237 N/A 4088243 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 4088243 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Fig. 2 boll-dazl-1 4088237 N/A 4088239 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 4088241 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3A boll-boll-1 4088237 N/A 4088241 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 4088241 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1A, 3A boll-boll-2 4088238 N/A 4088241 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4088241 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1B, lane 9 boll-pum2-2 4088238 N/A 4088241 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4088240 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1B, lane 10 pum2-pum2-1 4088238 N/A 4088240 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4088240 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1B, lane 12 pum2-boll-1 4088238 N/A 4088241 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4088240 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1B, lane 11