DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wimberly-2000-1 thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wimberly BT., Brodersen DE., Clemons WM., Morgan-Warren RJ., Carter AP., Vonrhein C., Hartsch T., Ramakrishnan V. ramak@mrc-lmb.cam.ac.uk Nature 2000 Only protein-protein interactions imex curation imex curation rs7_thet8 30S ribosomal protein S7 rpsG rps7 TTHA1696 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW mint One of the primary rRNA binding proteins, it binds directly to 3'-end of the 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center. Binds mRNA and the E site tRNA blocking its exit path in the ribosome. This blockage implies that this section of the ribosome must be able to move to release the deacetylated tRNA rshx_thet8 30S ribosomal protein Thx rpsU S31 TTHA1396 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGKGDRRTRRGKIWRGTYGKYRPRKKK rs20_thet8 30S ribosomal protein S20 rpsT rps20 TTHA1397 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA rs19_thet8 30S ribosomal protein S19 rpsS TTHA1688 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK rs18_thet8 30S ribosomal protein S18 rpsR TTHA0243 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEKLVRK rs17_thet8 30S ribosomal protein S17 rpsQ TTHA1683 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA rs16_thet8 30S ribosomal protein S16 rpsP TTHA1035 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAREGA rs15_thet8 30S ribosomal protein S15 rpsO TTHA1138 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG rs14z_thet8 30S ribosomal protein S14 type Z rpsZ rpsN TTHA1679 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW rs13_thet8 30S ribosomal protein S13 rpsM rps13 TTHA1667 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK rs12_thet8 30S ribosomal protein S12 rpsL TTHA1697 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK rs11_thet8 30S ribosomal protein S11 rpsK rps11 TTHA1666 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS rs10_thet8 30S ribosomal protein S10 TTHA1693 rpsJ protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR rs9_thet8 30S ribosomal protein S9 rpsI rps9 TTHA1464 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR rs8_thet8 30S ribosomal protein S8 rpsH TTHA1678 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW rs6_thet8 30S ribosomal protein S6 TS9 TTHA0245 rpsF protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA rs5_thet8 30S ribosomal protein S5 rpsE TTHA1675 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG rs4_thet8 30S ribosomal protein S4 rpsD rps4 TTHA1665 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR rs3_thet8 30S ribosomal protein S3 rpsC rps3 TTHA1686 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE rs2_thet8 30S ribosomal protein S2 rpsB rps2 TTHA0861 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPVEITVKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQEAEATETPEGESEVEA rpsb-rpsc-2 3974767 N/A 3974768 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974769 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974770 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974771 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974772 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974773 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974774 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974775 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974776 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974777 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974778 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974779 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974780 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974781 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974782 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974783 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974784 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974785 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974786 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3974787 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 physical association physical association false false false Table 1