DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ murphy-2020-1 entfl Enterococcus faecalis Streptococcus faecalis 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Murphy EL., Singh KV., Avila B., Kleffmann T., Gregory ST., Murray BE., Krause KL., Khayat R., Jogl G., Murphy EL., Singh KV., Avila B., Kleffmann T., Gregory ST., Murray BE., Krause KL., Khayat R., Jogl G. gerwald_jogl@brown.edu Scientific reports 2020 Only protein-protein interactions imex curation imex curation murphy-2020-2 entfl Enterococcus faecalis Streptococcus faecalis biochemical biochemical ms participant Identification by mass spectrometry ms participant Murphy EL., Singh KV., Avila B., Kleffmann T., Gregory ST., Murray BE., Krause KL., Khayat R., Jogl G., Murphy EL., Singh KV., Avila B., Kleffmann T., Gregory ST., Murray BE., Krause KL., Khayat R., Jogl G. gerwald_jogl@brown.edu Scientific reports 2020 Only protein-protein interactions imex curation imex curation a0a1b4xkw0_entfl 30S ribosomal protein S5 H9Q64_08980 rpsE BZG32_00890 EGW70_04440 EY666_01510 GTI81_10980 KUB3007_C01550 CUM81_00235 DAI13_00875 EU507_10420 H7D67_10220 protein protein entfl Enterococcus faecalis Streptococcus faecalis MVYIDPKHLELEDRVVAINRVTKVVKGGRRLRFAALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLVEVPMVGSTIPHEVIGVFGGGRILMKPAVEGSGVAAGGPVRAVLELAGVADITSKSLGSNTPINVVRATVEGLKQLKRAEEVAALRGKSVEEIIG a0a1b4xkt6_entfl 50S ribosomal protein L22 H9Q64_09040 rplV BZG32_00830 EGW70_04380 EY666_01570 GTI81_10920 KUB3007_C01420 CUM81_00295 DAI13_00815 EU507_10360 H7D67_10160 protein protein entfl Enterococcus faecalis Streptococcus faecalis MSEQITSAKATAKTVRTSPRKARLVIDLIRGKSVADAISILKFTPNKSAGIIEKVLMSAVANAENNFDLDVESLVVSEAFVNEGPTMKRFRPRAKGSASPINKRTSHITVVVTEK a0a1b4xmc1_entfl 50S ribosomal protein L21 H9Q64_05735 rplU BZG32_04720 EY666_08665 KUB3007_C07000 CUM81_06870 DAI13_04805 EU507_12375 H7D67_12990 protein protein entfl Enterococcus faecalis Streptococcus faecalis MYAIIKTGGKQVKVEVGQAIYVEKLNVEAGEKVVFDEVILVGGESTKVGAPTVAGATVEGTVEKHGKQKKVVTFQYKPKKHSHRKQGHRQPYTKVMIEAINA a0a1b4xm76_entfl 50S ribosomal protein L20 H9Q64_06015 rplT BZG32_04450 EY666_03490 KUB3007_C06490 CUM81_07635 DAI13_04535 EU507_12015 H7D67_12735 protein protein entfl Enterococcus faecalis Streptococcus faecalis MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKSAKEQVMNSYYYAFRDRRQKKRDFRKLWIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDAAAFTALAEQAKDALSK a0a1b4xpl8_entfl 50S ribosomal protein L19 H9Q64_01535 rplS BZG32_09320 EGW70_10030 EY666_12750 GTI81_10245 KUB3007_C15910 CUM81_09400 DAI13_09530 EU507_02955 H7D67_03430 protein protein entfl Enterococcus faecalis Streptococcus faecalis MNPLIQELTQEQLRTDIPAFRPGDTVRVHAKVVEGTRERIQLFEGVVIKRRGAGISETYTVRKVSNGVGVERTFPLHTPRVAQIEVVRYGKVRRAKLYYLRALHGKAARIKEIRR a0a1b4xks7_entfl 50S ribosomal protein L18 H9Q64_08985 rplR BZG32_00885 EGW70_04435 EY666_01515 GTI81_10975 KUB3007_C01540 CUM81_00240 DAI13_00870 EU507_10415 H7D67_10215 protein protein entfl Enterococcus faecalis Streptococcus faecalis MITKPDKNKTRQKRHRRVRNKISGTAECPRLNIFRSNKNIYAQVIDDVAGVTLASASALDKEISGGTKTETAAAVGKLVAERAAEKGIKKVVFDRGGYLYHGRVQALAEAARENGLEF a0a1b4xkx1_entfl 50S ribosomal protein L17 H9Q64_08930 GTI81_11030 KUB3007_C01650 rplQ BZG32_00940 EGW70_04490 EY666_01460 CUM81_00185 DAI13_00925 EU507_10470 H7D67_10270 protein protein entfl Enterococcus faecalis Streptococcus faecalis MSYRKLGRTSSQRKAMLRDITTDLIINERIVTTEARAKEVRSTVEKMITLGKRGDLHARRQAATFVRNEVASVREEDESIVVESALQKLFNDLGPRFAERQGGYTRILKTEPRRGDAAPMVVIEFVK a0a1b4xku1_entfl 50S ribosomal protein L16 H9Q64_09030 rplP BZG32_00840 EGW70_04390 EY666_01560 GTI81_10930 KUB3007_C01440 CUM81_00285 DAI13_00825 EU507_10370 H7D67_10170 protein protein entfl Enterococcus faecalis Streptococcus faecalis MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEWGLQATESHWITNRQIEAARIAMTRYMKRGGKVWIKIFPHKSYTSKAIGVRMGKGKGAPEGWVSPVKRGKIMFEIAGVPEEVAREALRLASHKLPVKTKIVKREEMGGESNEG a0a1b4xkt1_entfl 50S ribosomal protein L15 H9Q64_08970 rplO BZG32_00900 EGW70_04450 GTI81_10990 KUB3007_C01570 CUM81_00225 DAI13_00885 EU507_10430 H7D67_10230 protein protein entfl Enterococcus faecalis Streptococcus faecalis MKLHELKPAEGSRQVRNRVGRGTSSGNGKTAGRGQKGQKARSGGGVRLGFEGGQTPLFRRLPKRGFTNINRKDYAVVNLDTLNRFEDGTEVTPVVLKEAGIVKNEKAGIKVLADGELTKKLTVKAAKFSKSAQEAIEAAGGSIEVI a0a1b4xks1_entfl 50S ribosomal protein L14 H9Q64_09015 rplN BZG32_00855 EGW70_04405 EY666_01545 GTI81_10945 KUB3007_C01470 CUM81_00270 DAI13_00840 EU507_10385 H7D67_10185 protein protein entfl Enterococcus faecalis Streptococcus faecalis MIQQESRLRVADNSGAREILTIKVLGGSGRKTANIGDVIVATVKQATPGGVVKKGEVVKAVIVRTKSGARRADGSYIKFDENAAVIIRDDKSPRGTRIFGPVARELRENNFMKIVSLAPEVL a0a1b4xsb2_entfl 50S ribosomal protein L13 H9Q64_14805 rplM BZG32_15525 EGW70_09435 EY666_14930 GTI81_13995 CUM81_04965 DAI13_15995 EU507_05280 H7D67_08840 protein protein entfl Enterococcus faecalis Streptococcus faecalis MRTTYMAKAGEVERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHVDTGDFVIVINADKVKLTGKKATDKIYYRHSMYPGGLKSVTAGELRDKNSRRLIETSVKGMLPKNTLGRKQFTKLNVYGGAEHPHAAQQPEVLDITNLI a0a1b4xku3_entfl 50S ribosomal protein L6 H9Q64_08990 rplF BZG32_00880 EGW70_04430 EY666_01520 GTI81_10970 KUB3007_C01520 CUM81_00245 EU507_10410 H7D67_10210 protein protein entfl Enterococcus faecalis Streptococcus faecalis MSRIGNKVVVLPAGVEIKQDGNNITVKGPKGELTREFSSDIKMNIEGNEVTFTRPNDSKEMKTIHGTTRANFNNMVVGVSEGFQKALELIGVGYRAQVQGNKLTLNVGYSHPVEMTAPEGVTFEVPANTQVIVKGINKEVVGELAANIRGVRPPEPYKGKGIRYVGEFVRRKEGKTGK a0a1b4xks2_entfl 50S ribosomal protein L5 H9Q64_09005 rplE BZG32_00865 EGW70_04415 EY666_01535 KUB3007_C01490 CUM81_00260 DAI13_00850 EU507_10395 H7D67_10195 protein protein entfl Enterococcus faecalis Streptococcus faecalis MNRLKEKYIKEVTPSLVEKFNYSSVMQTPKVDKIVINMGVGDAVSNAKNLDKAVEELALITGQKPLITKAKKSIAGFRLREGMPIGAKVTLRGERMYEFLDKLVTVSLPRVRDFHGVSKKAFDGRGNYTLGIKEQLIFPEVDYDLVDKVRGMDIVIVTTANTDEESRELLAQLGMPFQK a0a1b4xku7_entfl 50S ribosomal protein L4 H9Q64_09060 rplD BZG32_00810 EGW70_04360 EY666_01590 GTI81_10900 KUB3007_C01380 CUM81_00315 DAI13_00795 EU507_10340 H7D67_10140 protein protein entfl Enterococcus faecalis Streptococcus faecalis MPNVALFKQDGTQNGEITLNEEIFGIEPNESVVYDAIIMQRASLRQGTHAVKNRSAVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAMKSVLSDKVAENNLVAVEGLSFDAPKTKEFKQVLANLSIDTKVLVVLENGNDFAALSARNLPNVSVVTSDNVSVLDVVSANKVLATQTALTQIEEVLA a0a1b4xkr3_entfl 50S ribosomal protein L3 H9Q64_09065 rplC BZG32_00805 EGW70_04355 EY666_01595 GTI81_10895 KUB3007_C01370 CUM81_00320 DAI13_00790 EU507_10335 H7D67_10135 protein protein entfl Enterococcus faecalis Streptococcus faecalis MTKGILGKKVGMTQIFTESGELIPVTVVEATPNVVLQVKTVETDGYEAIQVGYQDKREVLSNKPAKGHVAKANTAPKRFIKEFKNVELGEYEVGKEIKVDVFQAGDVVDVTGTTKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMGGDRVTIQNLEVVKVDVERNVILIKGNIPGAKKSLITIKSAVKAK a0a1b4xkr6_entfl 50S ribosomal protein L2 H9Q64_09050 rplB BZG32_00820 EGW70_04370 EY666_01580 GTI81_10910 CUM81_00305 DAI13_00805 EU507_10350 H7D67_10150 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAIKKYKPTTNGRRNMTSSDFAEITTSTPEKSLLQPLKNNAGRNNNGRITVRHQGGGHKRQYRVIDFKRNKDNVAAVVKTIEYDPNRSANIALVHYEDGVKAYILAPKGLEVGMRLVSGPEADIKVGNALPLENIPVGTVIHNIEMKPGKGGQLIRSAGTSAQVLGKEGKYVLIRLNSGEVRMILATCRATIGSVGNEQHELINIGKAGRSRWMRKRPTVRGSVMNPNDHPHGGGEGKTPIGRKAPVSPWGQPAIGYKTRNKKAKSDKLIVRRRTK a0a1b4xqj7_entfl 30S ribosomal protein S20 H9Q64_10805 rpsT BZG32_11490 EGW70_05600 EY666_01035 GTI81_05750 CUM81_12095 DAI13_12000 EU507_04835 H7D67_05430 protein protein entfl Enterococcus faecalis Streptococcus faecalis MPNIESAIKRVRTSANANAKNSSQTNAMRTAIKKFEEAVAAGADNVDALYNEAVKAVDMAATKGLIHKNKANRDKIRLSKLAK a0a1b4xkb3_entfl 30S ribosomal protein S18 H9Q64_15325 rpsR BZG32_00045 EGW70_06380 EY666_06715 GTI81_09115 KUB3007_C00090 CUM81_03990 DAI13_00045 EU507_09620 H7D67_09500 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAQQRRGGRKRRKVDYIAANHIEYIDYKDTELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLPFVSDEQ a0a1b4xks3_entfl 30S ribosomal protein S17 H9Q64_09020 rpsQ BZG32_00850 EGW70_04400 EY666_01550 GTI81_10940 KUB3007_C01460 CUM81_00275 DAI13_00835 EU507_10380 H7D67_10180 protein protein entfl Enterococcus faecalis Streptococcus faecalis MTEERNQRKVYQGRVVSDKMDKTITVVVETKKNHPIYGKRMKYSKKYKAHDENNTAKVGDIVKIMETRPLSATKRFRLLEVVEEAVII a0a1b4xp69_entfl 30S ribosomal protein S16 H9Q64_02505 rpsP BZG32_08415 EY666_03950 GTI81_04800 KUB3007_C14310 CUM81_06195 DAI13_08520 EU507_02810 H7D67_02300 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAVKIRLKRMGSKKSPFYRIVVADSRSPRDGRFIETVGTYNPLKDPAEVVLKEDLVLDWLSKGAQPSDTVRNILSKEGVMKKHHEAKNVKK a0a1b4xrw3_entfl 30S ribosomal protein S15 H9Q64_14085 rpsO BZG32_14810 EGW70_06635 EY666_09120 GTI81_10800 KUB3007_C24770 CUM81_11945 DAI13_15200 EU507_06335 H7D67_08035 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAISQERKNEIIKEYARHEGDTGSPEVQIAVLTEDINQLNEHARTHKKDHHSYRGLMKKIGHRRNLLAYLRKTDIQRYRELIQRLGLRR a0a1b4xkt0_entfl 30S ribosomal protein S14 type Z H9Q64_09000 rpsN rpsZ BZG32_00870 EGW70_04420 EY666_01530 GTI81_10960 KUB3007_C01500 CUM81_00255 DAI13_00855 EU507_10400 H7D67_10200 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAKKSMIAKNKRPAKHSTQAYTRCERCGRPHSVYRKFHLCRICFRELAYKGQIPGVKKASW a0a1b4xkt7_entfl 30S ribosomal protein S13 H9Q64_08945 rpsM BZG32_00925 EGW70_04475 EY666_01475 GTI81_11015 KUB3007_C01620 CUM81_00200 DAI13_00910 EU507_10455 H7D67_10255 protein protein entfl Enterococcus faecalis Streptococcus faecalis MARIAGVDIPRDKRVVVSLTYIYGIGNTTAKKVLANVGVSEDVRVRDLTNEQTDAIRAEIDKLKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPTRGQNTKNNARTRKGPTKTVAGKKK a0a1b4xkq7_entfl 30S ribosomal protein S12 H9Q64_09100 rpsL BZG32_00770 EGW70_04320 EY666_01630 GTI81_10860 KUB3007_C01300 CUM81_00355 DAI13_00755 EU507_10300 H7D67_10100 protein protein entfl Enterococcus faecalis Streptococcus faecalis MPTINQLVRKPRKSKVEKSDSPALNKGYNSFKKTQTNVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQSRSKYGTKRPKA a0a1b4xkv1_entfl 30S ribosomal protein S11 H9Q64_08940 rpsK BZG32_00930 EGW70_04480 EY666_01470 GTI81_11020 KUB3007_C01630 CUM81_00195 DAI13_00915 EU507_10460 H7D67_10260 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAAKKVSRKRRVKKNIESGVAHIHSTFNNTIVMITDTHGNALAWSSAGSLGFKGSKKSTPFAAQMAAEAATKVAMEHGLKTVDVTVKGPGSGREAAIRSLQATGLEVTAIRDVTPVPHNGCRPPKRRRV a0a1b4xkr5_entfl 30S ribosomal protein S10 H9Q64_09070 rpsJ BZG32_00800 EGW70_04350 EY666_01600 GTI81_10890 KUB3007_C01360 CUM81_00325 DAI13_00785 EU507_10330 H7D67_10130 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAKQKIRIRLKAYEHRILDQSADKIVETAKRTGADVSGPIPLPTERSLYTVIRATHKYKDSREQFEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL a0a1b4xsa2_entfl 30S ribosomal protein S9 H9Q64_14800 rpsI BZG32_15520 EGW70_09430 KUB3007_C26360 CUM81_04960 DAI13_15990 EU507_05285 H7D67_08835 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAQVQYSGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPFGVTETKGAYDVIVNVNGGGYAGQSGAIRHGIARALLQVDPDFRSALKRAGLLTRDARMVERKKPGLKKARKASQFSKR a0a1b4xks6_entfl 30S ribosomal protein S8 H9Q64_08995 rpsH BZG32_00875 EGW70_04425 EY666_01525 GTI81_10965 KUB3007_C01510 CUM81_00250 DAI13_00860 EU507_10405 H7D67_10205 protein protein entfl Enterococcus faecalis Streptococcus faecalis MVMTDPIADFLTRIRNANMVKHETLEVPASKIKRDIAEILKREGFIRDVEYIEDDKQGVIRVFLKYGKNEERVITNLKRISKPGLRAYVKADEVPKVLNGLGIAIISTSEGVITDKEARAKNIGGEVIAYVW a0a1b4xkq3_entfl 30S ribosomal protein S7 H9Q64_09095 rpsG BZG32_00775 EGW70_04325 EY666_01625 GTI81_10865 KUB3007_C01310 CUM81_00350 DAI13_00760 EU507_10305 H7D67_10105 protein protein entfl Enterococcus faecalis Streptococcus faecalis MPRKGPVAKRDVLPDPIYNSKLVTRLINRVMVDGKRGIAANIIYNSFDIIKESTGNDPLEVFEQAMKNVMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWVVNYARLRGEHTMEERLAKEIMDAANNTGASVKKREDTHKMADANRAFAHYRW a0a1b4xkb6_entfl 30S ribosomal protein S6 H9Q64_15315 rpsF BZG32_00035 EGW70_06370 EY666_06705 GTI81_09125 KUB3007_C00070 CUM81_04000 DAI13_00035 EU507_09610 H7D67_09490 protein protein entfl Enterococcus faecalis Streptococcus faecalis MSQDTKYEIMYIIRPNIDEEAKTALVERFDTILKDNGAEVIESKDWEKRRLAYEMNGFREGIYHIVNVTSPSTAGAINEFDRLAKINDDIIRHMIVKVEA a0a1b4xrv7_entfl 30S ribosomal protein S4 H9Q64_14110 rpsD BZG32_14835 EGW70_06610 EY666_04855 GTI81_10825 KUB3007_C24820 CUM81_11970 DAI13_15225 EU507_06310 H7D67_08060 protein protein entfl Enterococcus faecalis Streptococcus faecalis MSRYTGPSWKVSRRLGISLSGTGKELARRPYKPGQHGPNSRGKVSEYGMQLTEKQKLRHMYGMNERQFRTLFIKASKIKEGKHGVNFMVLLEQRLDNVVYRLGLATTRRQARQLVNHGHITVDGKRVDIPSYHVEVGQVIGVREKSQNISTIKEAVEATVGRPAFVSFDTEKLEGSFTRLPERDELYPEIDEALVVEYYNQKL a0a1b4xkr8_entfl 30S ribosomal protein S3 H9Q64_09035 rpsC BZG32_00835 EGW70_04385 EY666_01565 GTI81_10925 KUB3007_C01430 CUM81_00290 DAI13_00820 EU507_10365 H7D67_10165 protein protein entfl Enterococcus faecalis Streptococcus faecalis MGQKVHPIGMRVGIIRDWDAKWYAEKEYAEFLHEDLRIRKFIATKLADAAVSTIEIERAANRVNISIHTAKPGMVIGKGGSEVENLRKELNKLTGKRVHINIVEIKKPDLDAKLVGEGIARQLENRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIARSEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEILPTKKNTEKGGK a0a1b4xkt9_entfl 50S ribosomal protein L36 H9Q64_08950 rpmJ BZG32_00920 EGW70_04470 EY666_01480 GTI81_11010 KUB3007_C01610 CUM81_00205 DAI13_00905 EU507_10450 H7D67_10250 protein protein entfl Enterococcus faecalis Streptococcus faecalis MKVRPSVKPMCEHCKVIRRKGRVMVICPANPKHKQRQG a0a1b4xm73_entfl 50S ribosomal protein L35 H9Q64_06020 rpmI BZG32_04445 EY666_03485 GTI81_01520 KUB3007_C06480 CUM81_07640 DAI13_04530 EU507_12010 H7D67_12730 protein protein entfl Enterococcus faecalis Streptococcus faecalis MPKQKTHRGLAKRVKRTGGGGLKRGRAFTSHRFHGKTKKQRRQLRKASMVAKGDYKRIRQQLARMK a0a1b4xsi4_entfl 50S ribosomal protein L34 H9Q64_15280 rpmH BZG32_16190 EGW70_06335 EY666_06670 GTI81_09160 KUB3007_C27520 CUM81_04035 DAI13_16570 EU507_09575 H7D67_09455 protein protein entfl Enterococcus faecalis Streptococcus faecalis MKRTYQPNKRKRQKVHGFRKRMSTKNGRRVLASRRRKGRKVISA a0a1b4xr98_entfl 50S ribosomal protein L33 H9Q64_12835 rpmG BZG32_13880 EGW70_08635 EY666_13170 GTI81_03065 KUB3007_C23000 CUM81_06070 DAI13_13835 EU507_14715 H7D67_07140 protein protein entfl Enterococcus faecalis Streptococcus faecalis MRVNITLECTSCKERNYLTNKNKRNNPDRLEKQKYCPRERKVTLHRETK a0a1b4xmm2_entfl 50S ribosomal protein L32 H9Q64_05345 rpmF BZG32_05445 EGW70_05460 EY666_01915 GTI81_02210 KUB3007_C07780 CUM81_07095 DAI13_05210 EU507_14440 H7D67_13385 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAVPARRTSKAKKAKRRTHYKLTIKGLNACSNCGEMKKSHHVCPACGHYDGKDVMSKEA a0a1b4xkw1_entfl 50S ribosomal protein L30 H9Q64_08975 rpmD BZG32_00895 EGW70_04445 EY666_01505 GTI81_10985 KUB3007_C01560 CUM81_00230 DAI13_00880 EU507_10425 H7D67_10225 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAELKITLKRSVIGRPQNQRATVKALGLGKVNSTVTKPANEAIKGMVNTISHLVDVEEV a0a1b4xkv0_entfl 50S ribosomal protein L29 H9Q64_09025 rpmC BZG32_00845 EGW70_04395 EY666_01555 GTI81_10935 KUB3007_C01450 CUM81_00280 DAI13_00830 EU507_10375 H7D67_10175 protein protein entfl Enterococcus faecalis Streptococcus faecalis MKVKEIRELTTAEMLDKEKQLKEELFNLRFQLATGQLENTARIKEVRQSIARIKTVLREQAN a0a1b4xrz8_entfl 50S ribosomal protein L28 H9Q64_14315 rpmB BZG32_15015 EGW70_12080 EY666_07140 GTI81_08775 KUB3007_C25260 CUM81_14195 DAI13_15450 EU507_06120 H7D67_08285 protein protein entfl Enterococcus faecalis Streptococcus faecalis MAKVCYFTGRKTSSGNNRSHAMNSTKRTVKPNLQKVRVLIDGKPKKVWVSTRALKSGKIERV a0a1b4xmb1_entfl 50S ribosomal protein L27 H9Q64_05725 rpmA BZG32_04730 GTI81_01805 KUB3007_C07020 CUM81_06860 DAI13_04815 EU507_12385 H7D67_13000 protein protein entfl Enterococcus faecalis Streptococcus faecalis MLLTMNLQLFAHKKGGGSTSNGRDSESKRLGAKSADGQTVTGGSILYRQRGTKIYPGVNVGIGGDDTLFAKVDGVVRFERKGRDKKQVSVYPVAN a0a1b4xkv5_entfl 50S ribosomal protein L24 H9Q64_09010 rplX BZG32_00860 EGW70_04410 EY666_01540 GTI81_10950 KUB3007_C01480 CUM81_00265 DAI13_00845 EU507_10390 H7D67_10190 protein protein entfl Enterococcus faecalis Streptococcus faecalis MFVKKGDKVKVITGKDKNKEGVVLAAFPKQDKVIVEGVNVVKKHQKPNQAAPQGGILEVEAPIHVSNVMVIDPSNGEATKVAFKEVDGKKVRVSKKTGEVLDK a0a1b4xkr7_entfl 50S ribosomal protein L23 H9Q64_09055 rplW BZG32_00815 EGW70_04365 EY666_01585 GTI81_10905 KUB3007_C01390 CUM81_00310 DAI13_00800 EU507_10345 H7D67_10145 protein protein entfl Enterococcus faecalis Streptococcus faecalis MELLDVIKRPVITEKSMLAMDEKKYTFEVDTRANKTLVKQAVESAFDVKVANVNILNVRPKFKRMGKYAGYTKKRRKAIVTLTEDSKEIQLFEAAE a0a1b4xmv6_entfl 50S ribosomal protein L31 type B H9Q64_04680 rpmE2 BZG32_06165 EY666_00180 GTI81_04295 DAI13_05920 EU507_00510 H7D67_00090 CUM81_06585 protein protein entfl Enterococcus faecalis Streptococcus faecalis MKQDIHPNYQPVVFMDSTTGFKFLSGSTKGSSETVEWEDGNTYPLLRVEVTSDSHPFYTGRQKFTQADGRVDRFNKKYGLKDENANPDA a0a1x3al36_entfl 50S ribosomal protein L25 General stress protein CTC rplY ctc ELS84_1369 protein protein entfl Enterococcus faecalis Streptococcus faecalis MSVQLEVKERAIRPRSLRNQLRHEGKVPAIVYGYQIESTPIYFEEKDLSKILREHGANTVIKMTVDGKNINTLMSKAQLDTFTGQMLHVEFLSVNMKETTEVEAEVQLIGESAGVKAGGTLAQNLYTVLVAATPDKLPESIEVDITNLEIGDALTIADLPEHKDYEILTDPEEQLVAIVEAQTAPEEEEGTAAETIEPELAE The sequence has been withdrawn from uniprot. a0a1b4xks0_entfl 30S ribosomal protein S19 H9Q64_09045 rpsS BZG32_00825 EGW70_04375 EY666_01575 GTI81_10915 KUB3007_C01410 CUM81_00300 DAI13_00810 EU507_10355 H7D67_10155 protein protein entfl Enterococcus faecalis Streptococcus faecalis MGRSLKKGPFVDDHLMKKVEAQQGAEKKKVIKTWSRRSTIFPSFVGFTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYRGHVADDKKTKR rplb-rplc-7 3965420 N/A 3965422 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965423 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965424 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965425 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965426 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965427 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965428 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965429 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965430 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965431 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965432 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965433 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965434 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965435 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965436 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965437 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965438 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965439 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965440 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965441 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965442 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965443 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965444 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965445 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965446 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965447 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965448 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965449 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965450 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965451 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965452 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965453 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965454 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965455 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965456 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965457 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965458 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965459 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965460 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965461 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965462 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965463 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965464 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 physical association physical association false false false Fig 1, Supplementary Fig S1, S2, Table S3 rplb-rplc-8 3965420 N/A 3965454 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965455 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965456 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965457 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965458 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965465 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965459 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965460 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965461 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965462 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965466 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965463 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965464 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965423 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965424 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965425 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965426 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965427 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965428 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965429 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965430 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965431 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965432 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965433 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965434 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965435 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965436 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965437 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965438 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965467 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965439 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965440 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965441 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965442 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965443 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965444 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965445 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965446 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965447 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965448 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965449 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965450 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965451 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965422 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965452 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 N/A 3965453 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified entfl Enterococcus faecalis Streptococcus faecalis Stoichiometry: 1.0 physical association physical association false false false Fig 2, Supplementary Fig S2, Table S3 rplb-rplc-9 3965421 N/A 3965454 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965455 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965456 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965457 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965458 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965465 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965459 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965460 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965461 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965462 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965466 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965463 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965464 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965423 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965424 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965425 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965426 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965427 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965428 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965429 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965430 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965431 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965432 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965433 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965434 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965435 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965436 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965437 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965438 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965467 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965439 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965440 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965441 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965442 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965443 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965444 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965445 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965446 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965447 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965448 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965449 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965450 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965451 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965422 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965452 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3965453 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro physical association physical association false false false Table S1