DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ abbas-2020-2 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes experimental particp experimental participant identification experimental particp Abbas YM., Wu D., Bueler SA., Robinson CV., Rubinstein JL. john.rubinstein@utoronto.ca Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation abbas-2020-1 in vitro In vitro 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single experimental particp experimental participant identification experimental particp Abbas YM., Wu D., Bueler SA., Robinson CV., Rubinstein JL. john.rubinstein@utoronto.ca Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation q5zww6_legph lpg0968 protein protein legph Legionella pneumophila subsp. pneumophila MSFIKVGIKMGGLTSEQYHSQVVGKIGYIARCMQTIDPENNLKKIREDYQDVLIWAEKNYRFEEILEASKSGKCPNDLDALSRRSLILQELLRLVSSISPFKMKLDLIESQYEKMKQHVNLWKSDYHVKLNQLNQLTDYLKNAAPTPKNNFLRAMTSVLQMQIAQYGITEDNEGINQLFKLGLHLLAMANEKIDEQYHLFKGYVKDQPEESPFEGILPAEDQKILVKTMIDYAMPKLSSKVLQDKLSALSSSDVLTKTLLDSIDRIVKENEKLNALSKVKLGKFGLDIREIEVIYSQALKISPQDALQYTAQQCDAQLLSMAFPDSQNYIIESISNKKVKTIAELIHSKEFIYQIIKTEVFKQVDPNEKIRLQAATELYQLLGRIMDKQINLFTKMNLEQINEYIQTKTKAILDKIPERVELLTFMGFEIPTFKGIETLMTDISHSQDNETLAIAQEFYTNIKNAKNQLLGDKLIEDITPQDVEKFFNQCSQYGSEAAEKLADNRPVLTKIADILTAIARWAISLIGFNTPPQFLAPTRTCVDQVSDEITKIKLKLEDTLGSLQKVQEESLSL q8r2h0_rat V-type proton ATPase subunit G Atp6v1g2 Aif1 Bat1a Cdk2ap1-ps2 Cdk2ap1-ps3 Cdk2ap1-ps4 Cdk2ap1-ps5 Cdk2ap1-ps6 E230034O05Rik LOC224733l-3 LOC224733l-4 LOC224733l-5 LOC224733l-6 LOC224733l-7 LOC224733l-8 Lst1 RT1-CE12 RT1-CE3 RT1-CE5 RT1-CE6 RT1-CE8 RT1-CE9 Sacm2l-ps3 Sacm2l-ps4 Sacm2l-ps5 Sacm2l-ps6 Sacm2l-ps7 Tnf rCG_38311 protein protein rat Rattus norvegicus (Rat) Rat MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLTQLLGMVCDVRPQVHPNYRITV vatf_rat V-type proton ATPase subunit F Vacuolar proton pump subunit F V-ATPase 14 kDa subunit Atp6v1f Atp6s14 Vatf protein protein rat Rattus norvegicus (Rat) Rat MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR vatc1_rat V-type proton ATPase subunit C 1 Atp6v1c1 Vacuolar proton pump subunit C 1 protein protein rat Rattus norvegicus (Rat) Rat MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFKKAVDDFRHKARENKFIVRDFQYNEEEMRADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK vate1_rat V-type proton ATPase subunit E 1 Atp6v1e1 Vacuolar proton pump subunit E 1 protein protein rat Rattus norvegicus (Rat) Rat MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDLEAYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD q6p503_rat V-type proton ATPase subunit D Atp6v1d V-type proton ATPase subunit d Vacuolar proton pump subunit D rCG_61537 protein protein rat Rattus norvegicus (Rat) Rat MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKIIKEKSEKDLERRRAAGEVMEPANLLAEEKDEDLLFE vatb2_rat V-type proton ATPase subunit B, brain isoform Vacuolar proton pump subunit B 2 Endomembrane proton pump 58 kDa subunit Atp6v1b2 Atp6b2 Vat2 protein protein rat Rattus norvegicus (Rat) Rat MALRAMRGIVNGAAPELPVPTGGPMAGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFITQGPYENRTVYETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH d4a133_rat H(+)-transporting two-sector ATPase rCG_52629 Atp6v1a protein protein rat Rattus norvegicus (Rat) Rat MDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRSRGSVTYIAPPGNYDASDVVLELEFEGVKEKLSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDMQNAFRSLED renr_rat Renin receptor Atp6ap2 Atp6ip2 ATPase H(+)-transporting lysosomal accessory protein 2 ATPase H(+)-transporting lysosomal-interacting protein 2 Renin/prorenin receptor protein protein rat Rattus norvegicus (Rat) Rat MAVLVVLLSSLVSSALANEFSILRSPGSVVFRNGNWPIPGDRIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATIMVTVKGVDKLALPTGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLNSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDELGKRYGEDSEQFRDASRILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLVRKSRTILETKQENTQSPYNLAYKYNLEYSVVFNLVLWIMTGLALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD vatl_rat V-type proton ATPase 16 kDa proteolipid subunit Atp6v0c Atp6c Atp6l Atpl Vacuolar proton pump 16 kDa proteolipid subunit protein protein rat Rattus norvegicus (Rat) Rat MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK d3zim6_rat Rnasek protein protein rat Rattus norvegicus (Rat) Rat MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR va0e2_rat V-type proton ATPase subunit e 2 Atp6v0e2 Vacuolar proton pump subunit e 2 protein protein rat Rattus norvegicus (Rat) Rat MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE q5m7t6_rat V-type proton ATPase subunit Atp6v0d1 rCG_51062 protein protein rat Rattus norvegicus (Rat) Rat MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF vas1_rat V-type proton ATPase subunit S1 V-ATPase S1 accessory protein V-ATPase Ac45 subunit C7-1 protein Atp6ap1 Atp6ip1 Atp6s1 Vacuolar proton pump subunit S1 protein protein rat Rattus norvegicus (Rat) Rat MMAATVVSRIRTGTRWAPVLWLLLSLVAVAAAVAAEQQVPLVLWSSDRDLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLESEDVPYTAALTAVRPSRVARDVAMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAYKDEWKDLTSLTFGVENLNLTGSFWNDSFAMLSLTYEPLFGATVTFKFILASRFYPVSARYWFTMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSLSKKGSLLVTNVPSLWQMTLHNFQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDRKGPTITLTQIV b0k022_rat Atp6v0b Atp6v0b_predicted rCG_50448 protein protein rat Rattus norvegicus (Rat) Rat MTGLELLYLGIFVAFWACMIVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD p25286-1 V-type proton ATPase 116 kDa subunit a1 Atp6v0a1 Atp6n1 Vpp1 Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit Vacuolar adenosine triphosphatase subunit Ac116 Vacuolar proton pump subunit 1 Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1 protein protein rat Rattus norvegicus (Rat) Rat MGELFRSEEMTLAQLFLQSEAAYCCVSELEELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPNEMGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTIGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPESGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE atp6v1a-atp6v1b2-3 3723715 N/A 3723717 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 3723718 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723719 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723720 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723721 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723722 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723723 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723724 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 physical association physical association false false false Fig 1c atp6v1a-q5zww6_legph-1 3723715 N/A 3723717 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3723724 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 physical association physical association false false false Fig 1c atp6v1a-atp6v1b2-1 3723715 N/A 3723717 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 3723718 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723719 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723720 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 2.0 N/A 3723721 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723722 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723723 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723724 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 physical association physical association false false false Fig 1c atp6v1a-atp6v1b2-2 3723715 N/A 3723717 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 3723718 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723719 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723721 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723722 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723723 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723724 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 physical association physical association false false false Fig 1c atp6ap1-atp6ap2-1 3723716 N/A 3723725 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723726 structure determination identification by structure determination identification by structure determination structure determination monoclonal immunost monoclonal antibody immunostaining monoclonal immunost unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 16.0 N/A 3723727 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723728 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723729 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723730 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723731 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723732 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723717 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 3723718 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723719 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723720 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723721 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723722 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 1.0 N/A 3723723 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 N/A 3723724 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] Stoichiometry: 3.0 physical association physical association false false false Fig 1d, Fig S3