DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ andrew-2020-1 yeast Saccharomyces cerevisiae Baker's yeast 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Andrew M. Hartley , Natalya Lukoyanova, Yunyi Zhang, Alfredo Cabrera-Orefice, Susanne Arnold, Brigitte Meunier , Nikos Pinotsis  & Amandine Maréchal a.marechal@ucl.ac.uk Only protein-protein interactions imex curation imex curation andrew-2020-2 yeast Saccharomyces cerevisiae Baker's yeast ms interact detect detection by mass spectrometry ms interact detect ms participant Identification by mass spectrometry ms participant Andrew M. Hartley , Natalya Lukoyanova, Yunyi Zhang, Alfredo Cabrera-Orefice, Susanne Arnold, Brigitte Meunier , Nikos Pinotsis  & Amandine Maréchal a.marechal@ucl.ac.uk Only protein-protein interactions imex curation imex curation cox26_yeast Cytochrome c oxidase subunit 26, mitochondrial COX26 YDR119W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSKARKA cox13_yeast Cytochrome c oxidase subunit 13, mitochondrial COX13 YGL191W G1341 Cytochrome c oxidase polypeptide VIa protein protein yeast Saccharomyces cerevisiae Baker's yeast MFRQCAKRYASSLPPNALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHIEHDD cox12_yeast Cytochrome c oxidase subunit 12, mitochondrial COX12 Cytochrome c oxidase polypeptide VIb YLR038C protein protein yeast Saccharomyces cerevisiae Baker's yeast MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD cox9_yeast Cytochrome c oxidase subunit 9, mitochondrial COX9 YDL067C D2520 Cytochrome c oxidase polypeptide VIIA protein protein yeast Saccharomyces cerevisiae Baker's yeast MTIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKKQEN D228F428EA7DAC7C cox8_yeast Cytochrome c oxidase subunit 8, mitochondrial COX8 Cytochrome c oxidase polypeptide VIII L8084.14 YLR395C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKKSGAF cox7_yeast Cytochrome c oxidase subunit 7, mitochondrial Cytochrome c oxidase polypeptide VII YM9920.10C YMR256C COX7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA cox6_yeast Cytochrome c oxidase subunit 6, mitochondrial COX6 YHR051W Cytochrome c oxidase polypeptide VI protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS 91F2AF286BD2FB1A cox5a_yeast Cytochrome c oxidase subunit 5A, mitochondrial COX5A YNL052W N2474 YNL2474W Cytochrome c oxidase polypeptide Va protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK cox4_yeast Cytochrome c oxidase subunit 4, mitochondrial COX4 YGL187C G1362 Cytochrome c oxidase polypeptide IV protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSLRQSIRFFKPATRTLCSSRYLLQQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH cox3_yeast Cytochrome c oxidase subunit 3 Cytochrome c oxidase polypeptide III Q0275 COX3 OXI2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV cox2_yeast Cytochrome c oxidase subunit 2 COX2 OXI1 Q0250 Cytochrome c oxidase polypeptide II protein protein yeast Saccharomyces cerevisiae Baker's yeast MLDLLRLQLTTFIMNDVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ cox1_yeast Cytochrome c oxidase subunit 1 COX1 OXI3 Cytochrome c oxidase polypeptide I Q0045 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS qcr10_yeast Cytochrome b-c1 complex subunit 10, mitochondrial QCR10 Complex III subunit XI Complex III subunit 10 Ubiquinol-cytochrome c oxidoreductase subunit 10 Ubiquinol-cytochrome c reductase 8.5 kDa protein YHR001BW YHR001W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MAYTSHLSSKTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPLLGPTLEDHTPPEDKPN qcr9_yeast Cytochrome b-c1 complex subunit 9, mitochondrial QCR9 Ubiquinol-cytochrome c oxidoreductase subunit 9 Ubiquinol-cytochrome c reductase 7.3 kDa protein YGR183C Cytochrome c1 non-heme 7.3 kDa protein Complex III subunit X Complex III subunit 9 UCR9 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGDGDDDDE qcr8_yeast Cytochrome b-c1 complex subunit 8, mitochondrial QCR8 Ubiquinol-cytochrome c reductase complex 11 kDa protein Complex III subunit VII Complex III subunit 8 Ubiquinol-cytochrome c oxidoreductase subunit 8 Ubiquinone-binding protein QP-C J0526 YJL166W protein protein yeast Saccharomyces cerevisiae Baker's yeast MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV 9CB828E495F6ED9E qcr7_yeast Cytochrome b-c1 complex subunit 7, mitochondrial QCR7 Ubiquinol-cytochrome c oxidoreductase subunit 7 Ubiquinol-cytochrome c reductase 14 kDa protein D9719.32 YDR529C Complex III subunit 7 Complex III subunit VII CRO1 UCR7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK 1F1BA3DB6C4067B4 qcr6_yeast Cytochrome b-c1 complex subunit 6, mitochondrial QCR6 Cytochrome c1 non-heme 17 kDa protein Mitochondrial hinge protein Complex III subunit 6 Complex III subunit VI UCR6 Ubiquinol-cytochrome c oxidoreductase subunit 6 Ubiquinol-cytochrome c reductase 17 kDa protein YFR033C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDDDDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK ucri_yeast Cytochrome b-c1 complex subunit Rieske, mitochondrial RIP1 Rieske iron-sulfur protein Complex III subunit 5 Ubiquinol-cytochrome c oxidoreductase iron-sulfur subunit YEL024W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLGIRSSVKTCFKPMSLTSKRLISQSLLASKSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG 21981BD8492E86F3 cy1_yeast Cytochrome c1, heme protein, mitochondrial CYT1 Cytochrome b-c1 complex subunit 4 Complex III subunit 4 Complex III subunit IV CTC1 Ubiquinol-cytochrome c oxidoreductase cytochrome c1 subunit YOR29-16 YOR065W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITASTLLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK cyb_yeast Cytochrome b COB Ubiquinol-cytochrome c oxidoreductase complex cytochrome b subunit Q0105 Cytochrome b-c1 complex subunit CYTB Cytochrome b-c1 complex subunit 3 Complex III subunit 3 Complex III subunit III Complex III subunit CYTB CYTB protein protein yeast Saccharomyces cerevisiae Baker's yeast MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK qcr2_yeast Cytochrome b-c1 complex subunit 2, mitochondrial QCR2 Ubiquinol-cytochrome c oxidoreductase core protein 2 P9677.6 YPR191W Core protein II Complex III subunit 2 COR2 UCR2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSAARLQFAQGSVRRLTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL 51FDE1C5DA4420D0 qcr1_yeast Cytochrome b-c1 complex subunit 1, mitochondrial COR1 QCR1 Ubiquinol-cytochrome c oxidoreductase core protein 1 Ubiquinol-cytochrome c reductase 44 kDa protein YBL0403 YBL045C Complex III subunit 1 Core protein I protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRTVTSKTVSNQFKRSLATAVATPKAEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW AE58739EFB695254 rcf2_yeast Respiratory supercomplex factor 2, mitochondrial RCF2 AIM38 Altered inheritance of mitochondria protein 38 N3185 YNR018W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKILTQDEIEAHRSHTLKGGIEGALAGFAISAIIFKVLPRRYPKFKPSTLTWSIKTALWITPPTVLTAICAEEASNNFDATMYGSGSSSEDALDEHRRWKSLSTKDKFVEGLSNNKYKIITGAWAASLYGSWVIVNKDPIMTKAQKIVQARMYAQFITVGLLLASVGLSMYENKLHPNKQKVNEMRRWENALRVAEEEERLEKEGRRTGYVSNEERINSKIFKS rcf1_yeast Respiratory supercomplex factor 1, mitochondrial RCF1 AIM31 Altered inheritance of mitochondria protein 31 YML030W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRMPSSFDVTERDLDDMTFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVRLGNKWKAQYYFRWRVGLQAATLVALVAGSFIYGTSGKELKAKEEQLKEKAKMREKLWIQELERREEETEARRKRAELARMKTLENEEEIKNLEKELSDLENKLGKK cob-cor1-2 3714861 N/A 3714863 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714864 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified HIS tag HIS tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714865 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714866 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714867 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714868 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714869 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714870 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714871 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714872 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714873 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714874 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714875 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714876 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714877 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714878 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714879 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714880 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714881 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714882 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714883 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 N/A 3714884 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 2.0 physical association physical association false false false Fig 1, Table 1, Supplementary Fig 2 cob-cor1-3 3714862 N/A 3714863 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714875 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714876 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714877 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714878 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714879 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714883 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714884 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714880 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714881 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714882 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714885 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714886 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714864 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714865 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714866 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714867 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714868 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714869 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714870 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714871 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714872 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714873 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3714874 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro physical association physical association false false false Supplementary Table 1