IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kennedy-2017-1 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Kennedy AT., Wijeyewickrema LC., Huglo A., Lin C., Pike R., Cowman AF., Tham WH. PfMSP3.1 is the same protein as MSP3; see PMID: 23717506:" the first-discovered msp3 gene in P. falciparum, now designated as pfmsp3.1 (Ref:pmid:PMID: 19404387) " tham@wehi.edu.au Journal of immunology (Baltimore, Md. : 1950) 2017 Only protein-protein interactions imex curation imex curation a0a7d5sld3_plafa MSP-3 protein protein plafa Plasmodium falciparum MKSFINITLSLFLLHLYIYINNVASKEIVKKYNLNLRNAILNNNSQIENEEKDIKYELNEQNDENVNTPIVGNSMEFGGFTADDEKDMEAYKKAKEASQDAEKAAEEAEKAAEQAGQASKDAEKLKESDESYTKAKEACTAASKVKKAFETASNAKKAAESALKTNETGERNSRNNFYTTKTKEYAGKVEKDYERAKNAYQKANQAVLKAKEASSYDYILGWEFGGGVPEHKKEENMLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEEKNEEETEEEELEEKNEEETESEISEDEEEEEEEEEEKEEENDKKKEQEKEQSNENNDQKKDMEAQNLISKNQNNNEKNVKEAAESIMKTLAGLIKGNNQIDSTLKDLVEELSKYFKNH ic1_human Plasma protease C1 inhibitor SERPING1 C1IN C1NH C1 esterase inhibitor C1-inhibiting factor Serpin G1 protein protein human Homo sapiens Human MASRLTLLTLLLLLLAGDRASSNPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPILEVSSLPTTNSTTNSATKITANTTDEPTTQPTTEPTTQPTIQPTQPTTQLPTDSPTQPTTGSFCPGPVTLCSDLESHSTEAVLGDALVDFSLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRVLSNNSDANLELINTWVAKNTNNKISRLLDSLPSDTRLVLLNAIYLSAKWKTTFDPKKTRMEPFHFKNSVIKVPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVPQNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLNLCGLTEDPDLQVSAMQHQTVLELTETGVEAAAASAISVARTLLVFEVQQPFLFVLWDQQHKFPVFMGRVYDPRA serping1-msp_3-1 3961782 N/A 3961783 sequence tag sequence tag identification sequence tag western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate plafa-merozoite plafa merozoite merozoite merozoite N/A 3961784 unspecified role unspecified role bait bait purified purified human-blood human blood blood BLOOD physical association physical association false false false 2 A/B, 4B Removal of N- and O-linked glycosyl groups did not affect the interaction. serping1-msp_3-2 3961782 N/A 3961783 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait cell lysate cell lysate plafa-merozoite plafa merozoite merozoite merozoite N/A 3961784 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified human-blood human blood blood BLOOD physical association physical association false false false 2C, 4A Removal of N- and O-linked glycosyl groups did not affect the interaction. serping1-msp_3-3 3961782 N/A 3961783 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate plafa-merozoite plafa merozoite merozoite merozoite N/A 3961784 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false serpin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 4D Removal of N- and O-linked glycosyl groups did not affect the interaction. msp_3-serping1-1 3961782 N/A 3961783 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait cell lysate cell lysate plafa-merozoite plafa merozoite merozoite merozoite N/A 3961784 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false serpin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 4C Removal of N- and O-linked glycosyl groups did not affect the interaction.