UniProt UniProt http://www.uniprot.org maeda-2015-1 human-rcm1 Human rectum adenocarcinoma RCM-1 cells rcm1 Human rectum adenocarcinoma RCM-1 cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Maeda K., Saigo C., Kito Y., Sakuratani T., Yoshida K., Takeuchi T. takeutit08@gmail.com Journal of Cancer 2015 Only protein-protein interactions imex curation imex curation maeda-2015-2 human-colon_cancer human colonic cancer tissue Human colon_cancer Colon cancer tisuue pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Maeda K., Saigo C., Kito Y., Sakuratani T., Yoshida K., Takeuchi T. takeutit08@gmail.com Journal of Cancer 2015 Only protein-protein interactions imex curation imex curation itln1_human Intelectin-1 ITLN1 INTL ITLN LFR Endothelial lectin HL-1 Galactofuranose-binding lectin Intestinal lactoferrin receptor Omentin UNQ640/PRO1270 protein protein human Homo sapiens Human MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR tm207_human Transmembrane protein 207 TMEM207 UNQ846/PRO1784 protein protein human Homo sapiens Human MSRSRLFSVTSAISTIGILCLPLFQLVLSDLPCEEDEMCVNYNDQHPNGWYIWILLLLVLVAALLCGAVVLCLQCWLRRPRIDSHRRTMAVFAVGDLDSIYGTEAAVSPTVGIHLQTQTPDLYPVPAPCFGPLGSPPPYEEIVKTT itln1-tmem207-1 3948399 N/A 3948401 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3948402 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3A tmem207-itln1-1 3948400 N/A 3948401 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3948402 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3B