IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wanaguru-2013-1 in vitro In vitro avexis avexis avidity-based extracellular interaction screen AVidity-based EXtracellular Interaction Screen avexis predetermined predetermined participant predetermined Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ., Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ. Avexis assay: Ref. 12 from the supplement states " All proteins were produced by transient transfection using a HEK293E expression system". ENSPTRP00000017252 (Chimpanzee BSG protein) from Ensembl release 64 ( year 2011) cannot be found. The sequence entered has been taken from Uniprot entry A0A0M5L610 which has the best match to the sequence shown in Figure S3, with mutations entered for differences in sequences between the two entries. gw2@sanger.ac.uk, jr9@sanger.ac.uk, bhahn@upenn.edu Proceedings of the National Academy of Sciences of the United States of America 2013 Only protein-protein interactions imex curation imex curation wanaguru-2013-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ., Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ. ENSPTRP00000017252 (Chimpanzee BSG protein) from Ensembl release 64 ( year 2011) cannot be found. The sequence entered has been taken from Uniprot entry A0A0M5L610 which has the best match to the sequence shown in Figure S3, with mutations entered for differences in sequences between the two entries. gw2@sanger.ac.uk, jr9@sanger.ac.uk, bhahn@upenn.edu Proceedings of the National Academy of Sciences of the United States of America 2013 Only protein-protein interactions imex curation imex curation q8ibe8_plaf7 PF3D7_0731500 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MKCNISIYFFASFFVLYFAKARNEYDIKENEKFLDVYKEKFNELDKKKYGNVQKTDKKIFTFIENKLDILNNSKFNKRWKSYGTPDNIDKNMSLINKHNNEEMFNNNYQSFLSTSSLIKQNKYVPINAVRVSRILSFLDSRINNGRNTSSNNEVLSNCREKRKGMKWDCKKKNDRSNYVCIPDRRIQLCIVNLSIIKTYTKETMKDHFIEASKKESQLLLKKNDNKYNSKFCNDLKNSFLDYGHLAMGNDMDFGGYSTKAENKIQEVFKGAHGEISEHKIKNFRKKWWNEFREKLWEAMLSEHKNNINNCKNIPQEELQITQWIKEWHGEFLLERDNRSKLPKSKCKNNTLYEACEKECIDPCMKYRDWIIRSKFEWHTLSKEYETQKVPKENAENYLIKISENKNDAKVSLLLNNCDAEYSKYCDCKHTTTLVKSVLNGNDNTIKEKREHIDLDDFSKFGCDKNSVDTNTKVWECKKPYKLSTKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDKEVCKIINKTFADIRDIIGGTDYWNDLSNRKLVGKINTNSNYVHRNKQNDKLFRDEWWKVIKKDVWNVISWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQDKTKMIETLKVECKEKPCEDDNCKRKCNSYKEWISKKKEEYNKQAKQYQEYQKGNNYKMYSEFKSIKPEVYLKKYSEKCSNLNFEDEFKEELHSDYKNKCTMCPEVKDVPISIIRNNEQTSQEAVPEESTEIAHRTETRTDERKNQEPANKDLKNPQQSVGENGTKDLLQEDLGGSRSEDEVTQEFGVNHGIPKGEDQTLGKSDAIPNIGEPETGISTTEESRHEEGHNKQALSTSVDEPELSDTLQLHEDTKENDKLPLESSTITSPTESGSSDTEETPSISEGPKGNEQKKRDDDSLSKISVSPENSRPETDAKDTSNLLKLKGDVDISMPKAVIGSSPNDNINVTEQGDNISGVNSKPLSDDVRPDKNHEEVKEHTSNSDNVQQSGGIVNMNVEKELKDTLENPSSSLDEGKAHEELSEPNLSSDQDMSNTPGPLDNTSEETTERISNNEYKVNEREGERTLTKEYEDIVLKSHMNRESDDGELYDENSDLSTVNDESEDAEAKMKGNDTSEMSHNSSQHIESDQQKNDMKTVGDLGTTHVQNEISVPVTGEIDEKLRESKESKIHKAEEERLSHTDIHKINPEDRNSNTLHLKDIRNEENERHLTNQNINISQERDLQKHGFHTMNNLHGDGVSERSQINHSHHGNRQDRGGNSGNVLNMRSNNNNFNNIPSRYNLYDKKLDLDLYENRNDSTTKELIKKLAEINKCENEISVKYCDHMIHEEIPLKTCTKEKTRNLCCAVSDYCMSYFTYDSEEYYNCTKREFDDPSYTCFRKEAFSSMPYYAGAGVLFIILVILGASQAKYQSSEGVMNENNENNFLFEVTDNLDKLSNMFNQQVQETNINDFSEYHEDINDINFKK glpa_human Glycophorin-A PAS-2 Sialoglycoprotein alpha MN sialoglycoprotein GYPA GPA protein protein human Homo sapiens Human MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ q9n9g9_plare EBP protein protein Plasmodium reichenowi Plasmodium reichenowi SFFVLYFAKARNEYDIKENEKFLEVYKEKFNELDKKKYGNVQKTDKKIFSFIENKLDILNNSKSNKRWKSYGTPDNIDKNMSLINKYNNKETFNNNYQSFLSTSSLIKQNRYVPINAVRVSRILSFLDSKINNGRNTSSNDGDLRNCREKRKGNEWDCKKKNGTSNYVCIPDRRIQLCIVNLSIIKTYTKETMKDHFIEASRRESQLLLKKNDNNYNSKFCNDLKNSFLDYGHLAMGNDMDFGGYSTKAENKIQEVFKGVHGKISEHEIKNFRKKWWNEFREKLWEAMISEHKNNLSDCKNIPEEELQINQWIKEWHGEFLSERNNRLKLPKSKCKNNTLYEACAKECIDPCMKYRDWIIKSKFEWHTLSKEYERKNVSNKDAEKYLIKFSKNNDAKVSLLLDKCDAEYSKYCDCKHTTTLVKSVLNGKDNTSKEERETIDLDDFSKFGCDKNSVDTNRKEWECKKPYILSTKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDNEVCNVINKSFADIRDIIKGSDYWNDLSNRKLVGKINTNSKYVHKNKENDKLFRDEWWNVIKKDVWNVMSWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQYKLKMIDTLKVACEEKGYDDITCKNKCSSYKDWISKQKYLYDKQVTIYKEYQRNNNRIYPIVKTMEPKVYLKEYSKKCSNINFEDEFNEEVHSDYKNKCMISTKVLDVPIPAEKNVTEALETVVPKENTEIERKNESDTEEQKNQEIPNNYLKDSQQRVGENGTKVSSQEDLRGSRNEEGVTQEFGLNDEIPKGEEQISGKSGVIQNRSESEMGISTSEESRHEEGHNEQTLSTSVDQSELSDTLQSHEDTKENDELPLASSTITSPMESGSSDTEETQSISEGPKGNEQKERDDDSSSKISVSPEISRTETHDKDTSNLLRLKEDVDISMPKAVIGKDPNDHINNTAEGDHISGVNSSPLSDGVRPDKNHEEVKEHTSNPDNVQQSGENVNMNVENQLKDTLENTSSSLGEGKAHEELSEPNLSSGQDMSNTPAPLDNTSEETTERISNNEYKVNEREDERTLTKEYEDIVLKSHMNRESDDDELDGKNSDVPTVNDESEDVEEKMKRNDTSEISEDSSQHIESDQQENDMKTVGDLGTIHVQNEINDSVTGENKEQTVHGDEGVRLSHKDKHKINLEDKNSNILHLKDMRNEENERKQLANQNINISQQRDLQEHGFHTMNNLHGDGVSEGSQINHGNPVKRQDRGKPSGNVLNMGSNNNNFHNIPSRYNLYDKKLNLDLYVNRNDSTTKELIKKLAEINKCENEISAKYCSDMIDKEIPLKTCTKEKTINLCCAVADYCLSYFTYDSKEYSNCTKREFEDPSYTCFRKKGFSSMIFKFLITNKIYYYFYTYKNAKVTIKKINF v9xtm1_9apic EBA-175 protein protein Plasmodium sp. chimpanzee clade C3 Plasmodium sp. chimpanzee clade C3 FLDSRVNDRKNSSSNNGDLNNCREKRRGMKWECKKKNNTSNYVCIPDRRIQLCIVNLSIIKTYTKDSMKNHFIDASKRESELLFKKNNNKYDSKFCEDLKNSFLDYGHLAMGNDMDFGGYSSKAENKIQEVFKEAHGEVSEHEIKNFRKKWWNEFRNELWDAMISQHKNNFLSCKNIPEEELQINQWIKEWHGEFVLERNNISKLPKSKCKDNTLYEACEKECIDPCMKYRDWIIKSKFEWYTLSKEYDTQNVSNKNAENYLIRISNNNNNAKVSLLLKNCDAEYSKYCDCKHTTTLVKSVLNGKDDTSKEVRETVDLNDFSKFGCDEKSVETNRKMWECKKPDILSAKVICVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRLLKRKYGNKGDDEVCNAIKKSFADIRDIIKGSDYWNDLSNRKLVGKINSNSAYIKRNRENDKHFRDLWWEDIKKNVWHVMRWVFKDNNICKENDIVNVPQFFRWFSEWGDDYCQDKIKMIENLKVACKEKGCEDNNCKNKCSLYKEWILKEKEQYNKQAKQYQEYQKRNNYTMYSEFKSIKPEVYLNKYSKKCSNINFEIEFNEIFPSDYATKCTVCQEVKDVPIPIIRNDAETTQAVVPEE p35613-2 Basigin Short BSG 5F7 Collagenase stimulatory factor Extracellular matrix metalloproteinase inducer Leukocyte activation antigen M6 OK blood group antigen Tumor cell-derived collagenase stimulatory factor UNQ6505/PRO21383 Hepatoma-associated antigen Basigin-2 protein protein human Homo sapiens Human MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS rh5_plaf7 Reticulocyte-binding protein homolog 5 RH5 PFD1145c PF3D7_0424100 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MIRIKKKLILTIIYIHLFILNRLSFENAIKKTKNQENNLTLLPIKSTEEEKDDIKNGKDIKKEIDNDKENIKTNNAKDHSTYIKSYLNTNVNDGLKYLFIPSHNSFIKKYSVFNQINDGMLLNEKNDVKNNEDYKNVDYKNVNFLQYHFKELSNYNIANSIDILQEKEGHLDFVIIPHYTFLDYYKHLSYNSIYHKSSTYGKCIAVDAFIKKINETYDKVKSKCNDIKNDLIATIKKLEHPYDINNKNDDSYRYDISEEIDDKSEETDDETEEVEDSIQDTDSNHTPSNKKKNDLMNRTFKKMMDEYNTKKKKLIKCIKNHENDFNKICMDMKNYGTNLFEQLSCYNNNFCNTNGIRYHYDEYIHKLILSVKSKNLNKDLSDMTNILQQSELLLTNLNKKMGSYIYIDTIKFIHKEMKHIFNRIEYHTKIINDKTKIIQDKIKLNIWRTFQKDELLKRILDMSNEYSLFITSDHLRQMLYNTFYSKEKHLNNIFHHLIYVLQMKFNDVPIKMEYFQTYKKNKPLTQ a0a0m5l610_pantr Basigin BSG protein protein pantr Pan troglodytes (Chimpanzee) Chimpanzee MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAVLVCKSESVPPVTDWAWYKITDSGDKALMNGSESRFFVSSLQGRSELHIENLNMEADPGQYRCNGNSSEGSDQAVITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS g3s3k5_gorgo Basigin BSG protein protein Western lowland gorilla Gorilla gorilla gorilla MAAALFVLLGFALLGTHGASGAAGTVLTTVEELGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFEVDSDDQWGEYSCVFLPEPMGTANIQLHHGPPRVKAVKLSEHINEGETAVLACKSESVPPVTDWAWYKITDSGDKALTNGSESRFFVSSSQGRSELYIENLNMEADPGQYRCNGTSSKGSDQAVITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS gypa-q8ibe8_plaf7-1 3711510 N/A 3711512 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false RII region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 5.0 N/A 3711513 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false sialic acid carbohydrate chemical modification carbohydrate chemical modification carbohydrate chemical modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 1B gypa-ebp-3 3711510 N/A 3711514 unspecified role unspecified role prey prey purified purified RII region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 5.0 N/A 3711513 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false sialic acid carbohydrate chemical modification carbohydrate chemical modification carbohydrate chemical modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 1B gypa-eba_175-1 3711510 N/A 3711515 unspecified role unspecified role prey prey purified purified RII region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 5.0 N/A 3711513 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false sialic acid carbohydrate chemical modification carbohydrate chemical modification carbohydrate chemical modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 1B rh5-bsg-1 3711510 N/A 3711516 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 5.0 N/A 3711517 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 2A rh5-bsg-2 3711510 N/A 3711518 unspecified role unspecified role prey prey purified purified A0A0M5L610:p.[Gln164Pro;Glu168Lys;Arg184Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 5.0 N/A 3711517 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 2A rh5-bsg-3 3711510 N/A 3711519 unspecified role unspecified role prey prey purified purified G3S3K5:p.Gln100Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 5.0 N/A 3711517 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 2A rh5-bsg-6 3711510 N/A 3711517 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 5.0 N/A 3711518 unspecified role unspecified role bait bait purified purified A0A0M5L610:p.Val123Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A0A0M5L610:p.Leu163Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false A0A0M5L610:p.Glu191Lys mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain false A0A0M5L610:p.Asn188Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A0A0M5L610:p.Val197Ile mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A0A0M5L610:p.Gly146Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A0A0M5L610:p.Glu168Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 3A The mutations P164Q, and L184R also had no effect on the interaction. The mutation "G145E" has been entered as "G146E" as there is no "G" at position 145. The sequence used here for chimpanzee (PtBSG), Ensembl ENSPTRP00000017252, is "retired" - "This transcript is not in the current gene set.". Trembl entry A0A0M5L610 is the nearest match with >98% identity. The "mutations of no effect" P164Q, and L184R cannot be entered as there is already a Q and R residue in the current sequence A0A0M5L610. bsg-rh5-1 3711510 N/A 3711517 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 5.0 N/A 3711516 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P35613-2:p.Phe27Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P35613-2:p.Asp32Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P35613-2:p.Lys75Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P35613-2:p.Gln100Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P35613-2:p.His102_Gly103insHis mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 3C gypa-ebp-4 3711511 N/A 3711514 unspecified role unspecified role prey prey purified purified RII region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 1.0 N/A 3711513 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 1.0 direct interaction direct interaction false false false 3711511 1C gypa-eba_175-2 3711511 N/A 3711515 unspecified role unspecified role prey prey purified purified RII region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 1.0 N/A 3711513 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 1.0 direct interaction direct interaction false false false 3711511 1C gypa-q8ibe8_plaf7-2 3711511 N/A 3711512 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false RII region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 1.0 N/A 3711513 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 1.0 direct interaction direct interaction false false false 3711511 1C rh5-bsg-5 3711511 N/A 3711518 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false A0A0M5L610:p.[Gln164Pro;Glu168Lys;Arg184Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) N/A 3711517 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 3711511 2B, Supp. Fig. 5 bsg-rh5-2 3711511 N/A 3711517 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) Stoichiometry: 5.0 N/A 3711516 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P35613-2:p.Phe27Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P35613-2:p.Gln100Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P35613-2:p.His102_Gly103insHis mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false 3711511 2B, 3D, Supp. fig. 5 The affinities of the mutants F27L, Q100K, and +H103 for PfRH5 were lower than that of human BSG by approximately eightfold,11-fold, and 10-fold, respectively (Fig. 3D).